F259743

General Info

Members Datasets Scaffolds Average Seq Length
171 141 342 352

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2857472729|2857479007
Length 365
Sequence KDRDPKEKERAQQEKTMNLLLQMVAPGTPFRDGLENVLRAKTGALIVVGYSPEVMEVVDGGFSINCDFSPNYLYELAKMDGAIILNEDVKRILYANTQLIPDSSISSSETGIRHRTAERVAKQTGKLVVSISQRRNVITLYQGQLRYALKEMGVILTKANQAIQTLEKYRAVFTQALTNLSALEFEELVTMHEVAYVIQRAEMVLRINNEINRYVLELGNEGRLISMQKEELVGSAEDEAWLLLRDYAKDDAENKVREIQTTIRKLSSEELLDSASLIRILGYPSLSSVVEEGLLPRGHRMLSKIPRLPSIIIHNLVDRFAALPHIVMASIEELDEVDGIGEVRARAIKEGLKRIQEQVFIDRQI

Samples

Sample ID Description Type Environment
1 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
4 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
5 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
6 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
9 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
10 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
11 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
12 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
13 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
14 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
15 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
16 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
17 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
18 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
19 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
22 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
23 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
24 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
25 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
26 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
27 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
28 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
29 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
30 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
31 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
32 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
33 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
34 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
35 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
36 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
37 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
38 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
39 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
40 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
41 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
42 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
43 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
44 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
45 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
46 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
47 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
48 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
49 2857472729 Cohnella sp. R-74144 Isolate Unclassified
50 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
51 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
52 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
53 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
54 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
55 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
56 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
57 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
58 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
59 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
60 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
61 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
62 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
63 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
64 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
65 2671180694 Paenibacillus sp. A3 Isolate Unclassified
66 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
67 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
68 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
69 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
70 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
71 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
72 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
73 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
74 2818991459 Paenibacillus sp. 597 Isolate Unclassified
75 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
76 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
77 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
78 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
79 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
80 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
81 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
82 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
83 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
84 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
85 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
86 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
87 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
88 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
89 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
90 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
91 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
92 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
93 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
94 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
95 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
96 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
97 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
98 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
99 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
100 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
101 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
102 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
103 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
104 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
105 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
106 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
107 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
108 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
109 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
110 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
111 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
112 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
113 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
114 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
115 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
116 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
117 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
118 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
119 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
120 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
121 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
122 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
123 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
124 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
125 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
126 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
127 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
128 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
129 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
130 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
131 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified
132 8007375930 Clostridium sp. YIM B02565 Isolate Unclassified
133 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
134 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
135 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
136 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
137 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
138 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
139 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
140 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
141 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 45.03
Metatranscriptomes 0.58
Isolates 54.39

Biome Distribution

Category Percentage (%)
Aerial Root 1.17
Bulb 0
Endosphere 9.36
Nodule 5.26
Rhizoplane 0.58
Rhizosphere 41.52
Stem 0
Stem Tuber 0
Unclassified 1.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1005542 3300002737 Bacteria 2430
2 JGI25151J46595_10007444 3300003187 Bacteria 5365
3 Ga0055538_1000180 3300003751 Bacteria 39991
4 Ga0055532_1004537 3300003758 Bacteria 2077
5 Ga0055535_1009599 3300003761 Bacteria 1652
6 Ga0055541_1000148 3300003841 Bacteria 34526
7 Ga0055541_1003085 3300003841 Bacteria 3196
8 Ga0065704_10160528 3300005289 Bacteria 1358
9 Ga0079104_1001151 3300006946 Bacteria 19159
10 Ga0079104_1002091 3300006946 Bacteria 11440
11 Ga0079104_1003780 3300006946 Bacteria 6811
12 Ga0079104_1014909 3300006946 Bacteria 2327
13 Ga0105251_10009356 3300009011 Bacteria 5793
14 Ga0105244_10025640 3300009036 Bacteria 3201
15 Ga0105246_10017967 3300011119 Bacteria 4503
16 Ga0157371_10072973 3300013102 Bacteria 2430
17 Ga0209784_100141 3300025224 Bacteria 67045
18 Ga0209566_100588 3300025225 Bacteria 23106
19 Ga0209566_100775 3300025225 Bacteria 17114
20 Ga0209566_101316 3300025225 Bacteria 8013
21 Ga0209147_100210 3300025229 Bacteria 62804
22 Ga0209437_100331 3300025233 Bacteria 58796
23 Ga0209258_101019 3300025242 Bacteria 12680
24 Ga0209025_1003050 3300025294 Bacteria 16506
25 Ga0209025_1047168 3300025294 Bacteria 1763
26 Ga0207655_1011383 3300025728 Bacteria 5301
27 Ga0207713_1026374 3300025735 Bacteria 2664
28 Ga0209281_1000059 3300027111 Bacteria 295913
29 Ga0209281_1000435 3300027111 Bacteria 61761
30 Ga0209281_1009378 3300027111 Bacteria 2303
31 Ga0316576_10112566 3300031727 Unclassified 2041
32 Ga0316574_0051966 3300035398 Unclassified 2555
33 Ga0316582_0107390 3300036647 Bacteria 1855
34 Ga0400490_04567 3300038726 Bacteria 1957
35 Ga0400483_108286 3300039062 Bacteria 12836
36 Ga0439436_0006871 3300041404 Bacteria 3496
37 Ga0439449_0000208 3300042007 Bacteria 20706
38 Ga0466969_0002123 3300044656 Bacteria 10577
39 Ga0466961_0015230 3300044693 Bacteria 4938
40 Ga0453684_0033451 3300044712 Bacteria 7167
41 Ga0466959_0017919 3300045049 Bacteria 5195
42 Ga0495620_0095025 3300046515 Bacteria 1193
43 Ga0495637_0036291 3300046520 Bacteria 2148
44 Ga0495654_0109824 3300046530 Bacteria 1259
45 Ga0495672_0017742 3300047320 Bacteria 4750
46 Ga0495626_0017730 3300048091 Bacteria 3590
47 Ga0496116_0002747 3300048919 Bacteria 18082
48 Ga0496116_0005716 3300048919 Bacteria 11441
49 Ga0496116_0007509 3300048919 Bacteria 9650
50 Ga0496116_0011376 3300048919 Bacteria 7376
51 Ga0496116_0089995 3300048919 Bacteria 1870
52 Ga0496119_0000469 3300048922 Bacteria 54992
53 Ga0496119_0010940 3300048922 Bacteria 7577
54 Ga0496120_0003045 3300048923 Bacteria 15808
55 Ga0496120_0008977 3300048923 Bacteria 7151
56 Ga0496120_0099253 3300048923 Bacteria 1542
57 Ga0496121_0077110 3300048924 Bacteria 2655
58 Ga0496122_0006076 3300048925 Bacteria 14073
59 Ga0496122_0009213 3300048925 Bacteria 10453
60 Ga0496122_0015557 3300048925 Bacteria 7263
61 Ga0496122_0024433 3300048925 Bacteria 5287
62 Ga0496122_0034863 3300048925 Bacteria 4109
63 Ga0496122_0040098 3300048925 Bacteria 3727
64 Ga0496122_0099041 3300048925 Bacteria 1956
65 Ga0496123_0013838 3300048926 Bacteria 6732
66 Ga0496123_0023522 3300048926 Bacteria 4713
67 Ga0496124_0000697 3300048927 Bacteria 55040
68 Ga0496124_0001169 3300048927 Bacteria 41092
69 Ga0496124_0044647 3300048927 Bacteria 3801
70 Ga0496124_0081047 3300048927 Bacteria 2669
71 Ga0496125_0004005 3300048928 Bacteria 17323
72 Ga0496125_0004147 3300048928 Bacteria 16901
73 Ga0496126_0002905 3300048929 Bacteria 22320
74 Ga0496126_0005326 3300048929 Bacteria 14745
75 Ga0496126_0020762 3300048929 Bacteria 6429
76 Ga0496126_0031039 3300048929 Bacteria 5054
77 Ga0501306_002292 3300049127 Bacteria 1943
78 Ga0501076_0609516 3300049592 Bacteria 901
79 2857479007 2857472729 Bacteria 6568124
80 2512635707 2512564013 Bacteria 6286191
81 2512736558 2512564039 Bacteria 8739048
82 2524189964 2524023129 Bacteria 6762600
83 2550903183 2548877040 Bacteria 7507281
84 2563930158 2563366752 Bacteria 4961801
85 2571531563 2571042143 Bacteria 6986194
86 2573039790 2571042588 Bacteria 5045676
87 2578338918 2576861424 Bacteria 5270569
88 2580929947 2579778775 Bacteria 5360914
89 2587744106 2585428059 Bacteria 8696589
90 2595320905 2593339198 Bacteria 7267884
91 2601641718 2600255286 Bacteria 5390125
92 2621273330 2619619294 Bacteria 5575484
93 2643738809 2643221543 Bacteria 6628015
94 2644424526 2643221676 Bacteria 8119172
95 2673821690 2671180694 Bacteria 7506943
96 2723606226 2721755693 Bacteria 6126117
97 2728529856 2728368933 Bacteria 7044283
98 2730136849 2728369359 Bacteria 5621728
99 2745170140 2744054657 Bacteria 5016802
100 2753813112 2751185905 Bacteria 6142767
101 2793182107 2791355222 Bacteria 5898266
102 2802440692 2802428803 Bacteria 5806948
103 2817616422 2816332336 Bacteria 5207640
104 2819676067 2818991459 Bacteria 8736032
105 2821118288 2821111986 Bacteria 6894338
106 2831907817 2831905167 Bacteria 3319172
107 2857460070 2857453340 Bacteria 8090534
108 2857465596 2857460504 Bacteria 5194327
109 2857472317 2857465823 Bacteria 6772595
110 2857597817 2857591370 Bacteria 6569758
111 2864738904 2864733723 Bacteria 6770668
112 2865001990 2864997549 Bacteria 5139696
113 2865007607 2865002811 Bacteria 6333767
114 2881639837 2881636855 Bacteria 5205297
115 2885529948 2885526491 Bacteria 7164189
116 2888584495 2888578766 Bacteria 6743310
117 2889048042 2889042446 Bacteria 7618936
118 2889053058 2889049205 Bacteria 7524325
119 2889276779 2889276214 Bacteria 5979355
120 2889298977 2889295896 Bacteria 4704906
121 2898908911 2898907183 Bacteria 4067722
122 2904116945 2904113452 Bacteria 7796941
123 2904168121 2904162308 Bacteria 7086713
124 2904496982 2904490793 Bacteria 7046938
125 2904600748 2904595352 Bacteria 6124848
126 2904755706 2904755435 Bacteria 7986759
127 2907208234 2907202186 Bacteria 6632024
128 2915598668 2915597211 Bacteria 6475886
129 2915609963 2915606848 Bacteria 6032732
130 2916972047 2916971899 Bacteria 4250608
131 2919166215 2919160200 Bacteria 6929020
132 2919432379 2919425241 Bacteria 8055701
133 2925332805 2925326138 Bacteria 9652120
134 2929183815 2929183550 Bacteria 6377511
135 2929211915 2929206907 Bacteria 5918291
136 2931385148 2931384279 Bacteria 7299545
137 2938653424 2938649242 Bacteria 7118381
138 2939685090 2939679117 Bacteria 6921672
139 2939707570 2939702853 Bacteria 5139229
140 2945996228 2945991243 Bacteria 7008369
141 2946058918 2946053406 Bacteria 6978655
142 2964375254 2964375228 Bacteria 4909004
143 2968562401 2968558590 Bacteria 6956864
144 2971406719 2971403814 Bacteria 7370929
145 2971410895 2971410472 Bacteria 8311090
146 2971513756 2971511577 Bacteria 5404012
147 2980128542 2980125574 Bacteria 5567337
148 2980179409 2980176882 Bacteria 5397533
149 2980186784 2980182181 Bacteria 9454109
150 2981289488 2981284811 Bacteria 4641497
151 2981294492 2981289755 Bacteria 4641509
152 2981985148 2981980479 Bacteria 4641628
153 2981990079 2981985349 Bacteria 4641497
154 2984531193 2984527788 Bacteria 5288478
155 2984537302 2984532647 Bacteria 5288506
156 2988229908 2988225383 Bacteria 7221625
157 2996636905 2996632988 Bacteria 6921523
158 2996707517 2996706504 Bacteria 5757485
159 648172221 648028048 Bacteria 5394884
160 8002324020 8002317523 Bacteria 8051857
161 8007374632 8007371054 Bacteria 4849201
162 8007377045 8007375930 Bacteria 4080554
163 8046991355 8046991243 Bacteria 8497463
164 8054471347 8054465665 Bacteria 7323556
165 8054802027 8054795415 Bacteria 9785225
166 8055634052 8055632911 Bacteria 5283357
167 8056535642 8056533031 Bacteria 8964429
168 8057473418 8057473075 Bacteria 5892720
169 8057632251 8057632132 Bacteria 4726859
170 8057735176 8057733483 Bacteria 6578323
171 8057979837 8057977335 Bacteria 5694872
172 JGI25162J39368_1005542
173 JGI25151J46595_10007444
174 Ga0055538_1000180
175 Ga0055532_1004537
176 Ga0055535_1009599
177 Ga0055541_1000148
178 Ga0055541_1003085
179 Ga0065704_10160528
180 Ga0079104_1001151
181 Ga0079104_1002091
182 Ga0079104_1003780
183 Ga0079104_1014909
184 Ga0105251_10009356
185 Ga0105244_10025640
186 Ga0105246_10017967
187 Ga0157371_10072973
188 Ga0209784_100141
189 Ga0209566_100588
190 Ga0209566_100775
191 Ga0209566_101316
192 Ga0209147_100210
193 Ga0209437_100331
194 Ga0209258_101019
195 Ga0209025_1003050
196 Ga0209025_1047168
197 Ga0207655_1011383
198 Ga0207713_1026374
199 Ga0209281_1000059
200 Ga0209281_1000435
201 Ga0209281_1009378
202 Ga0316576_10112566
203 Ga0316574_0051966
204 Ga0316582_0107390
205 Ga0400490_04567
206 Ga0400483_108286
207 Ga0439436_0006871
208 Ga0439449_0000208
209 Ga0466969_0002123
210 Ga0466961_0015230
211 Ga0453684_0033451
212 Ga0466959_0017919
213 Ga0495620_0095025
214 Ga0495637_0036291
215 Ga0495654_0109824
216 Ga0495672_0017742
217 Ga0495626_0017730
218 Ga0496116_0002747
219 Ga0496116_0005716
220 Ga0496116_0007509
221 Ga0496116_0011376
222 Ga0496116_0089995
223 Ga0496119_0000469
224 Ga0496119_0010940
225 Ga0496120_0003045
226 Ga0496120_0008977
227 Ga0496120_0099253
228 Ga0496121_0077110
229 Ga0496122_0006076
230 Ga0496122_0009213
231 Ga0496122_0015557
232 Ga0496122_0024433
233 Ga0496122_0034863
234 Ga0496122_0040098
235 Ga0496122_0099041
236 Ga0496123_0013838
237 Ga0496123_0023522
238 Ga0496124_0000697
239 Ga0496124_0001169
240 Ga0496124_0044647
241 Ga0496124_0081047
242 Ga0496125_0004005
243 Ga0496125_0004147
244 Ga0496126_0002905
245 Ga0496126_0005326
246 Ga0496126_0020762
247 Ga0496126_0031039
248 Ga0501306_002292
249 Ga0501076_0609516
250 2857479007
251 2512635707
252 2512736558
253 2524189964
254 2550903183
255 2563930158
256 2571531563
257 2573039790
258 2578338918
259 2580929947
260 2587744106
261 2595320905
262 2601641718
263 2621273330
264 2643738809
265 2644424526
266 2673821690
267 2723606226
268 2728529856
269 2730136849
270 2745170140
271 2753813112
272 2793182107
273 2802440692
274 2817616422
275 2819676067
276 2821118288
277 2831907817
278 2857460070
279 2857465596
280 2857472317
281 2857597817
282 2864738904
283 2865001990
284 2865007607
285 2881639837
286 2885529948
287 2888584495
288 2889048042
289 2889053058
290 2889276779
291 2889298977
292 2898908911
293 2904116945
294 2904168121
295 2904496982
296 2904600748
297 2904755706
298 2907208234
299 2915598668
300 2915609963
301 2916972047
302 2919166215
303 2919432379
304 2925332805
305 2929183815
306 2929211915
307 2931385148
308 2938653424
309 2939685090
310 2939707570
311 2945996228
312 2946058918
313 2964375254
314 2968562401
315 2971406719
316 2971410895
317 2971513756
318 2980128542
319 2980179409
320 2980186784
321 2981289488
322 2981294492
323 2981985148
324 2981990079
325 2984531193
326 2984537302
327 2988229908
328 2996636905
329 2996707517
330 648172221
331 8002324020
332 8007374632
333 8007377045
334 8046991355
335 8054471347
336 8054802027
337 8055634052
338 8056535642
339 8057473418
340 8057632251
341 8057735176
342 8057979837

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10635

DisA-linker

DisA bacterial checkpoint controller linker region

149

290

0.98

PF02457

DAC

DisA bacterial checkpoint controller nucleotide-binding

31

145

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7y0d-assembly1.cif.gz_G cryo-em structure of the mycobacterium smegmatis dna integrity scanning protein (msdisa). 0.9545 11 349
7y0d-assembly1.cif.gz_G cryo-em structure of the mycobacterium smegmatis dna integrity scanning protein (msdisa). 0.9332 11 349
3c1y-assembly1.cif.gz_A structure of bacterial dna damage sensor protein with co-purified and co-crystallized ligand 0.9032 8 352
1x2i-assembly1.cif.gz_B crystal structure of archaeal xpf/mus81 homolog, hef from pyrococcus furiosus, helix-hairpin-helix domain 0.8965 294 345
4yxm-assembly1.cif.gz_A structure of thermotoga maritima disa d75n mutant with reaction product c-di-amp 0.894 8 352
ID Description Score Start End Superfamily
af_P9WNW5_7_141_3.40.1700.10 Alpha Beta;3-Layer(aba) Sandwich;YojJ-like (1;DNA integrity scanning protein, DisA, N-terminal domain 0.9888 12 142 3.40.1700.10
af_P9WNW5_142_292_1.20.1260.110 Mainly Alpha;Up-down Bundle;Ferritin;DNA integrity scanning linker region 0.9623 143 289 1.20.1260.110
af_P9WNW5_7_141_3.40.1700.10 Alpha Beta;3-Layer(aba) Sandwich;YojJ-like (1;DNA integrity scanning protein, DisA, N-terminal domain 0.9528 12 142 3.40.1700.10
af_P9WNW5_142_292_1.20.1260.110 Mainly Alpha;Up-down Bundle;Ferritin;DNA integrity scanning linker region 0.9313 143 289 1.20.1260.110
af_Q93456_191_254_1.10.150.20 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.929 294 346 1.10.150.20
ID Description Score Start End GO Terms
AF-X1SVH7-F1-model_v4 DAC domain-containing protein 0.9948 45 116 GO:0004016
GO:0005524
GO:0106408
AF-A0A2S8LKR1-F1-model_v4 deleted 0.9921 17 112
AF-A0A6V8P1Z1-F1-model_v4 Diadenylate cyclase 0.9897 8 124 GO:0004016
GO:0005524
GO:0106408
AF-A0A2W6FJA9-F1-model_v4 DNA integrity scanning protein DisA 0.9885 13 126 GO:0004016
GO:0005524
GO:0106408
AF-A0A7W0NFP8-F1-model_v4 deleted 0.988 12 104

Map