F259688

General Info

Members Datasets Scaffolds Average Seq Length
171 110 342 256

Family's Representative Sequence

Representative Sequence 3300060353|Ga0501082_0089944|Ga0501082_0089944_787_1659
Length 290
Sequence MSRPGPSPDAPRRPRGGGLRAPRRVRLDELVLARGLAASRAEAARLILAGRVRLDGALADKVGRLVRADAGVALLAAAPYVSRGGEKLAGALDALHVSPRDRVCLDVGASTGGFTDCLLGRGARHVHAVDVGHGQLHPRLRTDPRVSVHEHVNARAMDPATFEPPPSLATVDVAFISLDRVLPTVAACLARAEPPRDVLALVKPQFEVGRGRVGKGGVVRDAAQHREVLHRLSAFAADRGLAPQGVVASPLRGPKGNREFFLHLRPGGPAMPAGALEAAIDAATGPEEAA

Samples

Sample ID Description Type Environment
1 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
47 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
50 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
51 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
52 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
53 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
54 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
55 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
56 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
57 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
58 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
59 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
60 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
61 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
62 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
63 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
64 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
65 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
66 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
67 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
68 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
69 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
70 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
71 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
72 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
73 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
74 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
75 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
76 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
77 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
78 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
79 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
93 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
94 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
95 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
96 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
97 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
98 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
99 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
100 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
101 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
102 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
104 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
105 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
106 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
107 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
108 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
109 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified
110 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.83
Metatranscriptomes 0
Isolates 1.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.17
Rhizosphere 97.66
Stem 0
Stem Tuber 0
Unclassified 4.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501082_0089944 3300060353 Bacteria 2651
2 Ga0065707_10215946 3300005295 Bacteria 1245
3 Ga0068869_100054771 3300005334 Bacteria 2905
4 Ga0068868_100367060 3300005338 Bacteria 1236
5 Ga0070689_100343561 3300005340 Bacteria 1250
6 Ga0070669_100043258 3300005353 Bacteria 3280
7 Ga0070675_100626641 3300005354 Bacteria 977
8 Ga0070671_100642332 3300005355 Bacteria 919
9 Ga0070673_100189364 3300005364 Bacteria 1766
10 Ga0070688_100014543 3300005365 Bacteria 4462
11 Ga0070700_100038995 3300005441 Bacteria 2899
12 Ga0070706_100092691 3300005467 Bacteria 2802
13 Ga0070706_100107403 3300005467 Bacteria 2596
14 Ga0070707_100001284 3300005468 Bacteria 24727
15 Ga0070707_100069299 3300005468 Bacteria 3396
16 Ga0070707_100183864 3300005468 Bacteria 2038
17 Ga0070698_100020068 3300005471 Bacteria 7006
18 Ga0070698_100337084 3300005471 Bacteria 1439
19 Ga0070699_100069745 3300005518 Bacteria 3055
20 Ga0070699_100312415 3300005518 Bacteria 1411
21 Ga0070699_100397300 3300005518 Bacteria 1246
22 Ga0070697_100000006 3300005536 Bacteria 226483
23 Ga0070697_100027806 3300005536 Bacteria 4526
24 Ga0070697_100073093 3300005536 Bacteria 2814
25 Ga0070697_100425510 3300005536 Bacteria 1154
26 Ga0070695_100001423 3300005545 Bacteria 13261
27 Ga0070696_100230979 3300005546 Bacteria 1392
28 Ga0068857_100522966 3300005577 Bacteria 1115
29 Ga0068856_100424199 3300005614 Bacteria 1350
30 Ga0068859_100001654 3300005617 Bacteria 22705
31 Ga0068859_100006446 3300005617 Bacteria 11906
32 Ga0068861_100087348 3300005719 Bacteria 2454
33 Ga0068858_100320503 3300005842 Bacteria 1481
34 Ga0068862_100490672 3300005844 Bacteria 1164
35 Ga0081455_10161695 3300005937 Bacteria 1715
36 Ga0081540_1007667 3300005983 Bacteria 7655
37 Ga0070716_100074587 3300006173 Bacteria 2005
38 Ga0097620_100001654 3300006931 Bacteria 22705
39 Ga0097620_100006446 3300006931 Bacteria 11906
40 Ga0099794_10004529 3300007265 Bacteria 5476
41 Ga0105240_10022731 3300009093 Bacteria 8307
42 Ga0105240_10040010 3300009093 Bacteria 6001
43 Ga0111539_10003113 3300009094 Bacteria 21979
44 Ga0111539_10121336 3300009094 Bacteria 3062
45 Ga0111539_10486733 3300009094 Bacteria 1437
46 Ga0114129_10524853 3300009147 Bacteria 1543
47 Ga0157375_10384684 3300013308 Bacteria 1570
48 Ga0157380_10263115 3300014326 Bacteria 1568
49 Ga0157379_10288096 3300014968 Bacteria 1495
50 Ga0207684_10042775 3300025910 Bacteria 3841
51 Ga0207684_10101582 3300025910 Bacteria 2459
52 Ga0207684_10284755 3300025910 Bacteria 1425
53 Ga0207695_10019654 3300025913 Bacteria 7769
54 Ga0207646_10001265 3300025922 Bacteria 31666
55 Ga0207646_10121410 3300025922 Bacteria 2347
56 Ga0207646_10213696 3300025922 Bacteria 1742
57 Ga0207681_10046849 3300025923 Bacteria 2909
58 Ga0207706_10031910 3300025933 Bacteria 4693
59 Ga0207706_10488695 3300025933 Bacteria 1063
60 Ga0207665_10016675 3300025939 Bacteria 4825
61 Ga0207665_10112534 3300025939 Bacteria 1914
62 Ga0207667_10042742 3300025949 Bacteria 4815
63 Ga0207667_10138392 3300025949 Bacteria 2507
64 Ga0207677_10452198 3300026023 Bacteria 1101
65 Ga0207708_10047810 3300026075 Bacteria 3256
66 Ga0207675_100167699 3300026118 Bacteria 2097
67 Ga0207428_10034121 3300027907 Bacteria 4173
68 Ga0268265_10185177 3300028380 Bacteria 1793
69 Ga0268264_10097028 3300028381 Bacteria 2554
70 Ga0265342_10290720 3300031712 Unclassified 863
71 Ga0316576_10012108 3300031727 Bacteria 5688
72 Ga0316576_10119863 3300031727 Bacteria 1975
73 Ga0373932_0065717 3300035112 Bacteria 1113
74 Ga0373956_0002498 3300035119 Bacteria 7484
75 Ga0373927_0094537 3300035695 Bacteria 1942
76 Ga0373927_0259449 3300035695 Bacteria 1143
77 Ga0373937_0340753 3300036401 Bacteria 1420
78 Ga0373937_0776677 3300036401 Bacteria 906
79 Ga0316584_0094908 3300036712 Bacteria 2233
80 Ga0453683_0182455 3300044673 Bacteria 1331
81 Ga0453684_0208109 3300044712 Unclassified 2276
82 Ga0453684_0263098 3300044712 Bacteria 1975
83 Ga0451576_0010854 3300045051 Bacteria 10424
84 Ga0495629_0000012 3300046459 Bacteria 230331
85 Ga0495641_0058878 3300046461 Bacteria 1737
86 Ga0495651_0051111 3300046462 Bacteria 3188
87 Ga0495580_0164296 3300046472 Bacteria 1536
88 Ga0495582_0010671 3300046473 Bacteria 5053
89 Ga0495639_0007875 3300046475 Bacteria 4580
90 Ga0495594_0019240 3300046499 Bacteria 3627
91 Ga0495634_0008577 3300046642 Bacteria 7590
92 Ga0495635_0006523 3300046663 Bacteria 8142
93 Ga0495647_0025521 3300046681 Bacteria 2159
94 Ga0495658_0000011 3300046683 Bacteria 107037
95 Ga0495613_0002797 3300046689 Bacteria 13097
96 Ga0495581_0001759 3300047315 Bacteria 12088
97 Ga0495604_0065482 3300047317 Bacteria 2766
98 Ga0495676_0041517 3300047321 Bacteria 3785
99 Ga0495680_0004619 3300047322 Bacteria 13122
100 Ga0495680_0123262 3300047322 Unclassified 1911
101 Ga0495602_0075419 3300048088 Bacteria 2862
102 Ga0495614_0003982 3300048089 Bacteria 6629
103 Ga0496109_0306298 3300048912 Bacteria 1498
104 Ga0496112_0241031 3300048915 Bacteria 1761
105 Ga0501031_0000256 3300049568 Bacteria 29910
106 Ga0501031_0000705 3300049568 Bacteria 19943
107 Ga0501031_0033942 3300049568 Bacteria 3330
108 Ga0501032_0067384 3300049569 Bacteria 2391
109 Ga0501032_0071980 3300049569 Unclassified 2304
110 Ga0501033_0129612 3300049570 Bacteria 1828
111 Ga0501036_0018854 3300049572 Bacteria 5787
112 Ga0501036_0177901 3300049572 Unclassified 1791
113 Ga0501037_0009535 3300049573 Bacteria 7125
114 Ga0501037_0015354 3300049573 Bacteria 5635
115 Ga0501038_0007730 3300049574 Bacteria 9912
116 Ga0501038_0009568 3300049574 Bacteria 8892
117 Ga0501038_0245520 3300049574 Bacteria 1420
118 Ga0501039_0001609 3300049575 Bacteria 16640
119 Ga0501039_0040622 3300049575 Bacteria 3590
120 Ga0501039_0206548 3300049575 Bacteria 1544
121 Ga0501040_0012463 3300049576 Bacteria 5572
122 Ga0501040_0382279 3300049576 Unclassified 1010
123 Ga0501041_0003039 3300049577 Bacteria 9622
124 Ga0501041_0051583 3300049577 Bacteria 2507
125 Ga0501041_0056185 3300049577 Bacteria 2404
126 Ga0501041_0139694 3300049577 Bacteria 1510
127 Ga0501042_0001105 3300049578 Bacteria 15505
128 Ga0501042_0006959 3300049578 Bacteria 7381
129 Ga0501042_0107818 3300049578 Bacteria 2005
130 Ga0501043_0205123 3300049579 Unclassified 1529
131 Ga0501046_0028907 3300049580 Bacteria 4511
132 Ga0501046_0098784 3300049580 Bacteria 2241
133 Ga0501046_0231190 3300049580 Bacteria 1366
134 Ga0501048_0003755 3300049582 Bacteria 11590
135 Ga0501048_0124640 3300049582 Bacteria 1821
136 Ga0501068_0027950 3300049584 Bacteria 3333
137 Ga0501071_0169112 3300049587 Bacteria 1636
138 Ga0501072_0014740 3300049588 Bacteria 5994
139 Ga0501072_0014839 3300049588 Bacteria 5972
140 Ga0501072_0044511 3300049588 Bacteria 3490
141 Ga0501073_0628566 3300049589 Bacteria 741
142 Ga0501075_0000963 3300049591 Bacteria 18333
143 Ga0501075_0033465 3300049591 Bacteria 3824
144 Ga0501076_0000025 3300049592 Bacteria 78281
145 Ga0501076_0014625 3300049592 Bacteria 5917
146 Ga0501076_0150024 3300049592 Bacteria 1896
147 Ga0501077_0210003 3300049593 Bacteria 1237
148 Ga0501079_0011763 3300049741 Bacteria 6684
149 Ga0501079_0116881 3300049741 Bacteria 2073
150 Ga0501079_0132814 3300049741 Bacteria 1937
151 Ga0501080_0062423 3300049742 Bacteria 3468
152 Ga0501080_0152024 3300049742 Bacteria 2139
153 Ga0501081_0010139 3300049743 Bacteria 6147
154 Ga0501081_0023747 3300049743 Bacteria 4112
155 Ga0501081_0041132 3300049743 Bacteria 3165
156 Ga0501081_0060703 3300049743 Bacteria 2620
157 Ga0501035_0002547 3300049822 Bacteria 17825
158 Ga0501035_0171155 3300049822 Bacteria 1876
159 Ga0501045_0008606 3300049824 Bacteria 7112
160 nmdc:mga0qj67_248280_c1 3300050509 Bacteria 1444
161 nmdc:mga08y16_104042_c1 3300050511 Bacteria 2956
162 nmdc:mga08y16_745081_c1 3300050511 Bacteria 976
163 Ga0495619_0001912 3300053085 Bacteria 13875
164 Ga0501084_0008659 3300054114 Bacteria 8409
165 Ga0501084_0165127 3300054114 Unclassified 1869
166 Ga0501082_0002289 3300060353 Bacteria 16764
167 Ga0530510_0000006 3300061734 Bacteria 180585
168 Ga0530510_0016889 3300061734 Bacteria 5170
169 Ga0530510_0167768 3300061734 Bacteria 1626
170 2740990773 2740891818 Bacteria 6711283
171 2787509067 2786546548 Bacteria 4745694
172 Ga0501082_0089944
173 Ga0065707_10215946
174 Ga0068869_100054771
175 Ga0068868_100367060
176 Ga0070689_100343561
177 Ga0070669_100043258
178 Ga0070675_100626641
179 Ga0070671_100642332
180 Ga0070673_100189364
181 Ga0070688_100014543
182 Ga0070700_100038995
183 Ga0070706_100092691
184 Ga0070706_100107403
185 Ga0070707_100001284
186 Ga0070707_100069299
187 Ga0070707_100183864
188 Ga0070698_100020068
189 Ga0070698_100337084
190 Ga0070699_100069745
191 Ga0070699_100312415
192 Ga0070699_100397300
193 Ga0070697_100000006
194 Ga0070697_100027806
195 Ga0070697_100073093
196 Ga0070697_100425510
197 Ga0070695_100001423
198 Ga0070696_100230979
199 Ga0068857_100522966
200 Ga0068856_100424199
201 Ga0068859_100001654
202 Ga0068859_100006446
203 Ga0068861_100087348
204 Ga0068858_100320503
205 Ga0068862_100490672
206 Ga0081455_10161695
207 Ga0081540_1007667
208 Ga0070716_100074587
209 Ga0097620_100001654
210 Ga0097620_100006446
211 Ga0099794_10004529
212 Ga0105240_10022731
213 Ga0105240_10040010
214 Ga0111539_10003113
215 Ga0111539_10121336
216 Ga0111539_10486733
217 Ga0114129_10524853
218 Ga0157375_10384684
219 Ga0157380_10263115
220 Ga0157379_10288096
221 Ga0207684_10042775
222 Ga0207684_10101582
223 Ga0207684_10284755
224 Ga0207695_10019654
225 Ga0207646_10001265
226 Ga0207646_10121410
227 Ga0207646_10213696
228 Ga0207681_10046849
229 Ga0207706_10031910
230 Ga0207706_10488695
231 Ga0207665_10016675
232 Ga0207665_10112534
233 Ga0207667_10042742
234 Ga0207667_10138392
235 Ga0207677_10452198
236 Ga0207708_10047810
237 Ga0207675_100167699
238 Ga0207428_10034121
239 Ga0268265_10185177
240 Ga0268264_10097028
241 Ga0265342_10290720
242 Ga0316576_10012108
243 Ga0316576_10119863
244 Ga0373932_0065717
245 Ga0373956_0002498
246 Ga0373927_0094537
247 Ga0373927_0259449
248 Ga0373937_0340753
249 Ga0373937_0776677
250 Ga0316584_0094908
251 Ga0453683_0182455
252 Ga0453684_0208109
253 Ga0453684_0263098
254 Ga0451576_0010854
255 Ga0495629_0000012
256 Ga0495641_0058878
257 Ga0495651_0051111
258 Ga0495580_0164296
259 Ga0495582_0010671
260 Ga0495639_0007875
261 Ga0495594_0019240
262 Ga0495634_0008577
263 Ga0495635_0006523
264 Ga0495647_0025521
265 Ga0495658_0000011
266 Ga0495613_0002797
267 Ga0495581_0001759
268 Ga0495604_0065482
269 Ga0495676_0041517
270 Ga0495680_0004619
271 Ga0495680_0123262
272 Ga0495602_0075419
273 Ga0495614_0003982
274 Ga0496109_0306298
275 Ga0496112_0241031
276 Ga0501031_0000256
277 Ga0501031_0000705
278 Ga0501031_0033942
279 Ga0501032_0067384
280 Ga0501032_0071980
281 Ga0501033_0129612
282 Ga0501036_0018854
283 Ga0501036_0177901
284 Ga0501037_0009535
285 Ga0501037_0015354
286 Ga0501038_0007730
287 Ga0501038_0009568
288 Ga0501038_0245520
289 Ga0501039_0001609
290 Ga0501039_0040622
291 Ga0501039_0206548
292 Ga0501040_0012463
293 Ga0501040_0382279
294 Ga0501041_0003039
295 Ga0501041_0051583
296 Ga0501041_0056185
297 Ga0501041_0139694
298 Ga0501042_0001105
299 Ga0501042_0006959
300 Ga0501042_0107818
301 Ga0501043_0205123
302 Ga0501046_0028907
303 Ga0501046_0098784
304 Ga0501046_0231190
305 Ga0501048_0003755
306 Ga0501048_0124640
307 Ga0501068_0027950
308 Ga0501071_0169112
309 Ga0501072_0014740
310 Ga0501072_0014839
311 Ga0501072_0044511
312 Ga0501073_0628566
313 Ga0501075_0000963
314 Ga0501075_0033465
315 Ga0501076_0000025
316 Ga0501076_0014625
317 Ga0501076_0150024
318 Ga0501077_0210003
319 Ga0501079_0011763
320 Ga0501079_0116881
321 Ga0501079_0132814
322 Ga0501080_0062423
323 Ga0501080_0152024
324 Ga0501081_0010139
325 Ga0501081_0023747
326 Ga0501081_0041132
327 Ga0501081_0060703
328 Ga0501035_0002547
329 Ga0501035_0171155
330 Ga0501045_0008606
331 nmdc:mga0qj67_248280_c1
332 nmdc:mga08y16_104042_c1
333 nmdc:mga08y16_745081_c1
334 Ga0495619_0001912
335 Ga0501084_0008659
336 Ga0501084_0165127
337 Ga0501082_0002289
338 Ga0530510_0000006
339 Ga0530510_0016889
340 Ga0530510_0167768
341 2740990773
342 2787509067

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01728

FtsJ

FtsJ-like methyltransferase

80

266

0.97

PF01479

S4

S4 domain

25

72

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3opn-assembly1.cif.gz_A the crystal structure of a putative hemolysin from lactococcus lactis 0.9735 53 238
5eov-assembly1.cif.gz_A c-terminal domain of the 16s/23s rrna (cytidine-2'-o)-methyltransferase tlya. 0.9686 58 239
5opt-assembly1.cif.gz_b structure of ksrp in context of trypanosoma cruzi 40s 0.9546 2 42
1h3e-assembly1.cif.gz_A-2 tyrosyl-trna synthetase from thermus thermophilus complexed with wild-type trnatyr(gua) and with atp and tyrosinol 0.9306 1 50
1h3f-assembly1.cif.gz_A tyrosyl-trna synthetase from thermus thermophilus complexed with tyrosinol 0.9173 1 50
ID Description Score Start End Superfamily
3opnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.97 53 238 3.40.50.150
5eovA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9686 58 239 3.40.50.150
af_C0P590_106_292_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9671 63 238 3.40.50.150
af_Q8I5D3_12_67_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9499 1 51 3.10.290.10
af_Q5A6Q6_103_204_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9413 2 50 3.10.290.10
ID Description Score Start End GO Terms
AF-A0A2V5P173-F1-model_v4 Ribosomal RNA methyltransferase FtsJ domain-containing protein 1 172 239 GO:0008168
GO:0032259
AF-A0A258AED2-F1-model_v4 Ribosomal RNA methyltransferase FtsJ domain-containing protein 0.9914 79 239 GO:0008168
GO:0032259
AF-A0A3E0KKI0-F1-model_v4 TlyA family rRNA (Cytidine-2'-O)-methyltransferase 0.9907 58 238 GO:0008168
GO:0032259
AF-A0A2V6AJY6-F1-model_v4 TlyA family rRNA (Cytidine-2'-O)-methyltransferase 0.9902 82 239 GO:0008168
GO:0032259
AF-A0A1Q7SI60-F1-model_v4 Ribosomal RNA methyltransferase FtsJ domain-containing protein 0.9897 73 238 GO:0008168
GO:0032259

Map