F259646

General Info

Members Datasets Scaffolds Average Seq Length
171 106 342 477

Family's Representative Sequence

Representative Sequence 3300053077|Ga0495601_0080293|Ga0495601_0080293_175_1671
Length 498
Sequence LRGSGEIAVQALSKFVEDFWWLWPHITFCAYVVLTAAASAHLVLYKKDTRAAIGWIGVVVMVPIFGALLYSVFGINRLHRRAVSMRATSGQHWRTKQAARRAAEKALAVALPEGAERLASLEKLIDNLTGRPLLAGNRIKSLEGGEVAYPEMIAAIDGAQQSLAFSTYIFDNDAAGQAFADALARAVRRNVEVRVLIDAVGARYTFPSILHRLKADGIPVARFLPTLVPGRFTYANLRNHRKILVADGRIGFTGGLNIRAGHDARLNPPHPIIDHHFKIEGPVIAQLQEVFVSDWLFSTNETLEGPAWFPELKRLGTALARGISAGPDEDLDKLRLTLEGALSCASKSVCIMTPYFLPEAPLIAALNVAAMRGVEVDIILPEANNLALVKWASDAMLWQVLERGCRVWMSPAPFEHTKLMLVDQAWILFGSGNWDPRSLRLNFEFDVECYDTELADYLYRLMDEKRGRARLLTLADVDGRPLPIRLRNGVARLLTPYL

Samples

Sample ID Description Type Environment
1 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
13 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
17 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
18 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
19 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
20 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
21 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
22 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
37 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
38 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
39 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
40 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
41 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
42 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
43 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
44 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
45 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
46 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
47 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
48 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
49 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
50 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
51 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
52 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
53 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
54 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
55 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
56 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
57 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
58 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
59 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
60 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
61 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
62 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
63 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
64 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
65 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
66 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
67 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
68 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
69 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
70 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
71 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
72 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
85 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
86 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
87 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
88 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
89 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
90 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
91 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
92 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
93 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
94 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
95 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
97 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
98 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
99 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
100 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
101 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
102 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
103 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
104 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
105 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
106 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.17
Nodule 0
Rhizoplane 1.75
Rhizosphere 97.08
Stem 0
Stem Tuber 0
Unclassified 9.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495601_0080293 3300053077 Bacteria 2093
2 Ga0070680_100027546 3300005336 Bacteria 4550
3 Ga0070689_100010958 3300005340 Bacteria 6478
4 Ga0070671_100004063 3300005355 Bacteria 11548
5 Ga0070714_100018456 3300005435 Bacteria 5666
6 Ga0070701_10001095 3300005438 Bacteria 9891
7 Ga0070711_100001843 3300005439 Bacteria 11826
8 Ga0070705_100028151 3300005440 Bacteria 3075
9 Ga0070681_10000361 3300005458 Bacteria 36722
10 Ga0070697_100034956 3300005536 Bacteria 4054
11 Ga0068855_100136677 3300005563 Bacteria 2796
12 Ga0068857_100014171 3300005577 Bacteria 6942
13 Ga0068854_100055024 3300005578 Bacteria 2863
14 Ga0068852_100049690 3300005616 Bacteria 3589
15 Ga0068859_100188962 3300005617 Bacteria 2144
16 Ga0075428_100007717 3300006844 Bacteria 11922
17 Ga0075428_100045301 3300006844 Bacteria 4833
18 Ga0075430_100034017 3300006846 Bacteria 4325
19 Ga0075431_100262520 3300006847 Bacteria 1752
20 Ga0075433_10093115 3300006852 Unclassified 2666
21 Ga0075429_100003822 3300006880 Bacteria 12856
22 Ga0075429_100006655 3300006880 Bacteria 10017
23 Ga0075429_100013003 3300006880 Bacteria 7221
24 Ga0075436_100006920 3300006914 Bacteria 7758
25 Ga0097620_100188963 3300006931 Bacteria 2144
26 Ga0105240_10001407 3300009093 Bacteria 41286
27 Ga0105240_10055513 3300009093 Bacteria 4959
28 Ga0105240_10071666 3300009093 Unclassified 4284
29 Ga0105240_10243169 3300009093 Bacteria 2085
30 Ga0111539_10245037 3300009094 Bacteria 2087
31 Ga0114129_10010370 3300009147 Bacteria 13290
32 Ga0114129_10193119 3300009147 Bacteria 2763
33 Ga0105237_10120237 3300009545 Bacteria 2621
34 Ga0105238_10063179 3300009551 Bacteria 3703
35 Ga0157370_10015734 3300013104 Bacteria 7682
36 Ga0157369_10047538 3300013105 Bacteria 4657
37 Ga0163162_10023537 3300013306 Bacteria 6080
38 Ga0157372_10055936 3300013307 Bacteria 4408
39 Ga0157372_10239333 3300013307 Bacteria 2106
40 Ga0207695_10006014 3300025913 Bacteria 15858
41 Ga0207695_10031538 3300025913 Bacteria 5809
42 Ga0207695_10043882 3300025913 Bacteria 4760
43 Ga0207695_10059960 3300025913 Bacteria 3943
44 Ga0207644_10041901 3300025931 Bacteria 3241
45 Ga0207670_10006184 3300025936 Bacteria 6623
46 Ga0207674_10004696 3300026116 Bacteria 16388
47 Ga0265320_10040438 3300031240 Bacteria 2325
48 Ga0265327_10004945 3300031251 Bacteria 11464
49 Ga0316579_10036993 3300031691 Unclassified 2253
50 Ga0316576_10000776 3300031727 Bacteria 15972
51 Ga0316576_10001229 3300031727 Bacteria 13545
52 Ga0316576_10085666 3300031727 Bacteria 2342
53 Ga0316578_10000038 3300031728 Bacteria 26953
54 Ga0316578_10082677 3300031728 Unclassified 1912
55 Ga0316577_10039372 3300031733 Bacteria 2644
56 Ga0307409_100086669 3300031995 Bacteria 2550
57 Ga0307416_100156664 3300032002 Bacteria 2098
58 Ga0307416_100158470 3300032002 Bacteria 2088
59 Ga0316580_10026277 3300032139 Bacteria 1800
60 Ga0373943_0056145 3300035170 Unclassified 1953
61 Ga0373955_0030463 3300035172 Bacteria 2817
62 Ga0316574_0012849 3300035398 Bacteria 4801
63 Ga0373931_0055888 3300035691 Unclassified 2114
64 Ga0373935_0010342 3300035692 Bacteria 5596
65 Ga0373927_0061382 3300035695 Unclassified 2432
66 Ga0373947_0077892 3300035725 Unclassified 2045
67 Ga0316582_0012202 3300036647 Bacteria 4785
68 Ga0316584_0000242 3300036712 Bacteria 27283
69 Ga0316584_0057227 3300036712 Bacteria 2918
70 Ga0373925_0003193 3300037068 Bacteria 12819
71 Ga0439448_0009690 3300042005 Bacteria 2844
72 Ga0451577_0000041 3300042876 Bacteria 335318
73 Ga0451577_0001306 3300042876 Bacteria 34231
74 Ga0451577_0001733 3300042876 Bacteria 28107
75 Ga0451577_0007240 3300042876 Bacteria 10937
76 Ga0451577_0011114 3300042876 Bacteria 8542
77 Ga0451577_0015687 3300042876 Bacteria 7038
78 Ga0451577_0016898 3300042876 Bacteria 6747
79 Ga0451577_0017083 3300042876 Bacteria 6710
80 Ga0451577_0040453 3300042876 Bacteria 4185
81 Ga0451577_0138526 3300042876 Bacteria 2186
82 Ga0451577_0217286 3300042876 Bacteria 1727
83 Ga0453683_0000056 3300044673 Bacteria 192299
84 Ga0453683_0009952 3300044673 Bacteria 6324
85 Ga0453683_0044378 3300044673 Bacteria 2790
86 Ga0453683_0047871 3300044673 Bacteria 2681
87 Ga0453684_0000066 3300044712 Bacteria 465545
88 Ga0453684_0000596 3300044712 Bacteria 134106
89 Ga0453684_0002773 3300044712 Bacteria 41456
90 Ga0453684_0008350 3300044712 Bacteria 18605
91 Ga0453684_0012138 3300044712 Bacteria 14295
92 Ga0453684_0019796 3300044712 Bacteria 10213
93 Ga0453684_0023047 3300044712 Bacteria 9199
94 Ga0453684_0036059 3300044712 Bacteria 6823
95 Ga0453684_0062390 3300044712 Bacteria 4774
96 Ga0453684_0077357 3300044712 Bacteria 4171
97 Ga0453684_0077827 3300044712 Bacteria 4153
98 Ga0453684_0114098 3300044712 Bacteria 3276
99 Ga0453684_0212172 3300044712 Bacteria 2249
100 Ga0451576_0000541 3300045051 Bacteria 81256
101 Ga0451576_0002052 3300045051 Bacteria 31670
102 Ga0451576_0018346 3300045051 Bacteria 7672
103 Ga0451576_0083284 3300045051 Bacteria 3328
104 Ga0451576_0133691 3300045051 Bacteria 2586
105 Ga0451576_0141597 3300045051 Bacteria 2507
106 Ga0451576_0184099 3300045051 Bacteria 2181
107 Ga0451576_0195413 3300045051 Bacteria 2113
108 Ga0451576_0198552 3300045051 Bacteria 2095
109 Ga0495662_0063109 3300046476 Unclassified 1790
110 Ga0495630_0007954 3300046517 Bacteria 7610
111 Ga0495630_0030518 3300046517 Bacteria 4010
112 Ga0495666_0028370 3300046526 Unclassified 2753
113 Ga0495640_0038581 3300046533 Bacteria 3359
114 Ga0495586_0011682 3300046535 Bacteria 4670
115 Ga0495634_0009314 3300046642 Bacteria 7243
116 Ga0495634_0054354 3300046642 Unclassified 2681
117 Ga0495613_0054849 3300046689 Bacteria 2929
118 Ga0495613_0072413 3300046689 Unclassified 2512
119 Ga0495581_0023805 3300047315 Bacteria 3549
120 Ga0495676_0061791 3300047321 Unclassified 2928
121 Ga0496101_0062330 3300048904 Bacteria 2711
122 Ga0496102_0198029 3300048905 Unclassified 1893
123 Ga0496115_0002999 3300048918 Bacteria 12128
124 Ga0501032_0043123 3300049569 Bacteria 3057
125 Ga0501033_0019754 3300049570 Bacteria 5092
126 Ga0501034_0031562 3300049571 Bacteria 5381
127 Ga0501034_0100868 3300049571 Bacteria 2881
128 Ga0501036_0003488 3300049572 Bacteria 12570
129 Ga0501036_0115092 3300049572 Bacteria 2272
130 Ga0501038_0009162 3300049574 Bacteria 9084
131 Ga0501039_0001834 3300049575 Bacteria 15707
132 Ga0501040_0003496 3300049576 Bacteria 10145
133 Ga0501040_0178039 3300049576 Bacteria 1507
134 Ga0501041_0003891 3300049577 Bacteria 8603
135 Ga0501042_0001869 3300049578 Bacteria 12646
136 Ga0501046_0017625 3300049580 Bacteria 5955
137 Ga0501046_0059744 3300049580 Bacteria 2985
138 Ga0501047_0050819 3300049581 Bacteria 4003
139 Ga0501047_0100778 3300049581 Bacteria 2767
140 Ga0501048_0022725 3300049582 Bacteria 4584
141 Ga0501068_0017702 3300049584 Bacteria 4122
142 Ga0501070_0003743 3300049586 Bacteria 13133
143 Ga0501070_0140965 3300049586 Bacteria 1990
144 Ga0501071_0009179 3300049587 Bacteria 6574
145 Ga0501072_0005192 3300049588 Bacteria 9907
146 Ga0501074_0009555 3300049590 Bacteria 7044
147 Ga0501074_0129340 3300049590 Bacteria 1807
148 Ga0501075_0006005 3300049591 Bacteria 8320
149 Ga0501076_0018438 3300049592 Bacteria 5320
150 Ga0501077_0000691 3300049593 Bacteria 20403
151 Ga0501079_0002675 3300049741 Bacteria 12956
152 Ga0501080_0017694 3300049742 Bacteria 6594
153 Ga0501080_0129359 3300049742 Bacteria 2337
154 Ga0501081_0000179 3300049743 Bacteria 30121
155 Ga0501035_0000071 3300049822 Bacteria 126831
156 Ga0501044_0156990 3300049823 Bacteria 2254
157 Ga0501044_0202093 3300049823 Unclassified 1945
158 nmdc:mga05p37_5388_c1 3300050507 Bacteria 15038
159 nmdc:mga09592_3841_c1 3300050508 Bacteria 12098
160 nmdc:mga09592_51912_c1 3300050508 Bacteria 3459
161 nmdc:mga0qj67_63552_c1 3300050509 Bacteria 2935
162 nmdc:mga06r32_43609_c1 3300050510 Bacteria 4268
163 nmdc:mga08y16_17038_c1 3300050511 Bacteria 7651
164 nmdc:mga0a205_64267_c1 3300050515 Unclassified 3544
165 Ga0500568_0029478 3300053139 Bacteria 2277
166 Ga0500616_0007175 3300053153 Bacteria 7124
167 Ga0501082_0010111 3300060353 Bacteria 8126
168 Ga0530510_0007390 3300061734 Bacteria 7647
169 Ga0530510_0012930 3300061734 Bacteria 5870
170 Ga0530510_0064283 3300061734 Bacteria 2658
171 Ga0530510_0097130 3300061734 Bacteria 2153
172 Ga0495601_0080293
173 Ga0070680_100027546
174 Ga0070689_100010958
175 Ga0070671_100004063
176 Ga0070714_100018456
177 Ga0070701_10001095
178 Ga0070711_100001843
179 Ga0070705_100028151
180 Ga0070681_10000361
181 Ga0070697_100034956
182 Ga0068855_100136677
183 Ga0068857_100014171
184 Ga0068854_100055024
185 Ga0068852_100049690
186 Ga0068859_100188962
187 Ga0075428_100007717
188 Ga0075428_100045301
189 Ga0075430_100034017
190 Ga0075431_100262520
191 Ga0075433_10093115
192 Ga0075429_100003822
193 Ga0075429_100006655
194 Ga0075429_100013003
195 Ga0075436_100006920
196 Ga0097620_100188963
197 Ga0105240_10001407
198 Ga0105240_10055513
199 Ga0105240_10071666
200 Ga0105240_10243169
201 Ga0111539_10245037
202 Ga0114129_10010370
203 Ga0114129_10193119
204 Ga0105237_10120237
205 Ga0105238_10063179
206 Ga0157370_10015734
207 Ga0157369_10047538
208 Ga0163162_10023537
209 Ga0157372_10055936
210 Ga0157372_10239333
211 Ga0207695_10006014
212 Ga0207695_10031538
213 Ga0207695_10043882
214 Ga0207695_10059960
215 Ga0207644_10041901
216 Ga0207670_10006184
217 Ga0207674_10004696
218 Ga0265320_10040438
219 Ga0265327_10004945
220 Ga0316579_10036993
221 Ga0316576_10000776
222 Ga0316576_10001229
223 Ga0316576_10085666
224 Ga0316578_10000038
225 Ga0316578_10082677
226 Ga0316577_10039372
227 Ga0307409_100086669
228 Ga0307416_100156664
229 Ga0307416_100158470
230 Ga0316580_10026277
231 Ga0373943_0056145
232 Ga0373955_0030463
233 Ga0316574_0012849
234 Ga0373931_0055888
235 Ga0373935_0010342
236 Ga0373927_0061382
237 Ga0373947_0077892
238 Ga0316582_0012202
239 Ga0316584_0000242
240 Ga0316584_0057227
241 Ga0373925_0003193
242 Ga0439448_0009690
243 Ga0451577_0000041
244 Ga0451577_0001306
245 Ga0451577_0001733
246 Ga0451577_0007240
247 Ga0451577_0011114
248 Ga0451577_0015687
249 Ga0451577_0016898
250 Ga0451577_0017083
251 Ga0451577_0040453
252 Ga0451577_0138526
253 Ga0451577_0217286
254 Ga0453683_0000056
255 Ga0453683_0009952
256 Ga0453683_0044378
257 Ga0453683_0047871
258 Ga0453684_0000066
259 Ga0453684_0000596
260 Ga0453684_0002773
261 Ga0453684_0008350
262 Ga0453684_0012138
263 Ga0453684_0019796
264 Ga0453684_0023047
265 Ga0453684_0036059
266 Ga0453684_0062390
267 Ga0453684_0077357
268 Ga0453684_0077827
269 Ga0453684_0114098
270 Ga0453684_0212172
271 Ga0451576_0000541
272 Ga0451576_0002052
273 Ga0451576_0018346
274 Ga0451576_0083284
275 Ga0451576_0133691
276 Ga0451576_0141597
277 Ga0451576_0184099
278 Ga0451576_0195413
279 Ga0451576_0198552
280 Ga0495662_0063109
281 Ga0495630_0007954
282 Ga0495630_0030518
283 Ga0495666_0028370
284 Ga0495640_0038581
285 Ga0495586_0011682
286 Ga0495634_0009314
287 Ga0495634_0054354
288 Ga0495613_0054849
289 Ga0495613_0072413
290 Ga0495581_0023805
291 Ga0495676_0061791
292 Ga0496101_0062330
293 Ga0496102_0198029
294 Ga0496115_0002999
295 Ga0501032_0043123
296 Ga0501033_0019754
297 Ga0501034_0031562
298 Ga0501034_0100868
299 Ga0501036_0003488
300 Ga0501036_0115092
301 Ga0501038_0009162
302 Ga0501039_0001834
303 Ga0501040_0003496
304 Ga0501040_0178039
305 Ga0501041_0003891
306 Ga0501042_0001869
307 Ga0501046_0017625
308 Ga0501046_0059744
309 Ga0501047_0050819
310 Ga0501047_0100778
311 Ga0501048_0022725
312 Ga0501068_0017702
313 Ga0501070_0003743
314 Ga0501070_0140965
315 Ga0501071_0009179
316 Ga0501072_0005192
317 Ga0501074_0009555
318 Ga0501074_0129340
319 Ga0501075_0006005
320 Ga0501076_0018438
321 Ga0501077_0000691
322 Ga0501079_0002675
323 Ga0501080_0017694
324 Ga0501080_0129359
325 Ga0501081_0000179
326 Ga0501035_0000071
327 Ga0501044_0156990
328 Ga0501044_0202093
329 nmdc:mga05p37_5388_c1
330 nmdc:mga09592_3841_c1
331 nmdc:mga09592_51912_c1
332 nmdc:mga0qj67_63552_c1
333 nmdc:mga06r32_43609_c1
334 nmdc:mga08y16_17038_c1
335 nmdc:mga0a205_64267_c1
336 Ga0500568_0029478
337 Ga0500616_0007175
338 Ga0501082_0010111
339 Ga0530510_0007390
340 Ga0530510_0012930
341 Ga0530510_0064283
342 Ga0530510_0097130

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13396

PLDc_N

Phospholipase_D-nuclease N-terminal

33

74

0.95

PF00614

PLDc

Phospholipase D Active site motif

235

262

0.92

PF13091

PLDc_2

PLD-like domain

338

465

0.92

PF13091

PLDc_2

PLD-like domain

152

295

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1byr-assembly1.cif.gz_A crystal structure of a phospholipase d family member, nuc from salmonella typhimurium 0.8851 301 457
1byr-assembly1.cif.gz_A crystal structure of a phospholipase d family member, nuc from salmonella typhimurium 0.8742 301 457
4gel-assembly1.cif.gz_A crystal structure of zucchini 0.8467 319 456
4gel-assembly1.cif.gz_B crystal structure of zucchini 0.8465 319 456
4gem-assembly1.cif.gz_B crystal structure of zucchini (k171a) 0.8327 304 456
ID Description Score Start End Superfamily
af_P0A6H8_316_458_3.30.870.10 Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A 0.9928 316 454 3.30.870.10
af_P0AA84_201_339_3.30.870.10 Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A 0.9758 316 448 3.30.870.10
af_Q2FWG8_323_468_3.30.870.10 Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A 0.9725 316 456 3.30.870.10
af_Q2FYW4_304_492_3.30.870.10 Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A 0.9617 294 480 3.30.870.10
af_P0A6H8_316_458_3.30.870.10 Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A 0.9585 316 454 3.30.870.10
ID Description Score Start End GO Terms
AF-A0A5A7N7N8-F1-model_v4 Phospholipase D (Choline phosphatase) 0.9842 304 482 GO:0005576
GO:0008808
GO:0016020
GO:0032049
AF-A0A800N8P3-F1-model_v4 Cardiolipin synthetase (EC 2.7.8.-) 0.9821 330 482 GO:0008808
GO:0016020
GO:0032049
AF-A0A7Y2VMV6-F1-model_v4 PLD phosphodiesterase domain-containing protein 0.9789 320 482 GO:0008808
GO:0016020
GO:0032049
AF-A0A4Q2WGC7-F1-model_v4 deleted 0.9787 348 482
AF-H0I2S4-F1-model_v4 Phospholipase D (Choline phosphatase) 0.9781 323 482 GO:0005576
GO:0008808
GO:0016020
GO:0032049

Map