F259512

General Info

Members Datasets Scaffolds Average Seq Length
171 124 342 261

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0025488|Ga0501031_0025488_2197_3075
Length 292
Sequence MPLAGEHFSPSEQRSAEMSERSRYQPGAPCWVDTLQPDPEAAMRFYSELFGWEFVGSGHMPGGSPGQYFVARLRGRDVAGVGSQPAAGAPPTPAWNTYIAVANAEKTVERANNAGGVILAGPLDALPAGRLAVLTDPAGARFCIWEPGLRQGAQLVNEASAWALSLLHTGDLTRAQAFYADVFGWRHEAFETAGELTLCRLPGYVGGQPEQPVPRDVVAVMVPLDRAAAPAEEPPHWSVDFWTDDTDAAASKAPALGGRVVVPPYSPPGFRTAVLSDPHGAVFSVSTLIVDR

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
31 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
32 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
33 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
34 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
35 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
53 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
54 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
55 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
56 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
57 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
58 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
59 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
60 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
61 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
62 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
63 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
64 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
65 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
66 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
67 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
68 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
69 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
70 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
71 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
72 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
73 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
74 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
75 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
76 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
77 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
78 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
79 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
80 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
81 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
82 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
83 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
84 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
85 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
86 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
87 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
88 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
89 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
90 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
91 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
92 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
93 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
94 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
95 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
96 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
97 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
98 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
99 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
100 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
101 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
102 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
103 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
104 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
105 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
106 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
112 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
113 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
114 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
115 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
116 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
117 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
118 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
119 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
120 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
121 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
122 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
123 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
124 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.34
Nodule 0
Rhizoplane 7.02
Rhizosphere 77.19
Stem 0
Stem Tuber 0
Unclassified 2.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0025488 3300049568 Bacteria 3856
2 JGI25407J50210_10011884 3300003373 Bacteria 2229
3 Ga0070683_100224842 3300005329 Bacteria 1784
4 Ga0070660_100093042 3300005339 Bacteria 2380
5 Ga0070669_100079440 3300005353 Bacteria 2440
6 Ga0070675_100695638 3300005354 Bacteria 926
7 Ga0070674_100107569 3300005356 Bacteria 2042
8 Ga0070674_100316331 3300005356 Bacteria 1250
9 Ga0070709_10209531 3300005434 Unclassified 1385
10 Ga0070714_100114274 3300005435 Bacteria 2395
11 Ga0070713_100150028 3300005436 Bacteria 2073
12 Ga0070713_100457544 3300005436 Bacteria 1199
13 Ga0070701_10171053 3300005438 Bacteria 1265
14 Ga0070711_100026780 3300005439 Bacteria 3781
15 Ga0070662_100064039 3300005457 Bacteria 2691
16 Ga0068867_100163716 3300005459 Bacteria 1756
17 Ga0070698_100024441 3300005471 Bacteria 6304
18 Ga0068855_100150129 3300005563 Unclassified 2650
19 Ga0070664_100207842 3300005564 Bacteria 1749
20 Ga0068857_100329664 3300005577 Bacteria 1411
21 Ga0068856_100011393 3300005614 Bacteria 8627
22 Ga0081538_10000068 3300005981 Bacteria 97659
23 Ga0081538_10008026 3300005981 Bacteria 9024
24 Ga0081540_1025177 3300005983 Bacteria 3432
25 Ga0081539_10011061 3300005985 Bacteria 7214
26 Ga0081539_10012636 3300005985 Bacteria 6475
27 Ga0070717_10017466 3300006028 Bacteria 5583
28 Ga0075364_10142408 3300006051 Bacteria 1613
29 Ga0070712_100003175 3300006175 Bacteria 10126
30 Ga0075367_10317804 3300006178 Bacteria 981
31 Ga0075369_10057414 3300006186 Bacteria 1693
32 Ga0105245_10924335 3300009098 Bacteria 915
33 Ga0114129_10155908 3300009147 Bacteria 3123
34 Ga0157375_10500482 3300013308 Unclassified 1379
35 Ga0157375_10652911 3300013308 Bacteria 1208
36 Ga0213873_10008519 3300021358 Bacteria 2097
37 Ga0213874_10001585 3300021377 Bacteria 4755
38 Ga0213876_10001600 3300021384 Bacteria 13920
39 Ga0213876_10002546 3300021384 Bacteria 10672
40 Ga0213876_10018131 3300021384 Bacteria 3715
41 Ga0213876_10212959 3300021384 Bacteria 1027
42 Ga0213875_10007060 3300021388 Bacteria 5839
43 Ga0213875_10072989 3300021388 Bacteria 1601
44 Ga0207688_10247466 3300025901 Bacteria 1079
45 Ga0207693_10000696 3300025915 Bacteria 30225
46 Ga0207663_10003405 3300025916 Bacteria 7777
47 Ga0207659_10173493 3300025926 Bacteria 1702
48 Ga0207659_10410655 3300025926 Bacteria 1134
49 Ga0207664_10017967 3300025929 Bacteria 5197
50 Ga0207706_10062364 3300025933 Bacteria 3282
51 Ga0207709_10042282 3300025935 Bacteria 2740
52 Ga0207669_10090091 3300025937 Bacteria 1994
53 Ga0207665_10243332 3300025939 Bacteria 1326
54 Ga0207689_10136578 3300025942 Bacteria 2019
55 Ga0207661_10304231 3300025944 Bacteria 1430
56 Ga0207679_10069366 3300025945 Bacteria 2652
57 Ga0207679_10074443 3300025945 Bacteria 2573
58 Ga0207640_10130743 3300025981 Bacteria 1814
59 Ga0207708_10003757 3300026075 Bacteria 11188
60 Ga0207702_10012544 3300026078 Bacteria 7048
61 Ga0207648_10031556 3300026089 Bacteria 4684
62 Ga0207648_10386102 3300026089 Bacteria 1267
63 Ga0207675_100420833 3300026118 Bacteria 1319
64 Ga0307405_10141389 3300031731 Bacteria 1679
65 Ga0307413_10046756 3300031824 Bacteria 2576
66 Ga0307410_10149006 3300031852 Bacteria 1740
67 Ga0307406_10254226 3300031901 Bacteria 1325
68 Ga0307407_10025112 3300031903 Bacteria 3136
69 Ga0307409_100290409 3300031995 Bacteria 1516
70 Ga0307409_101020497 3300031995 Bacteria 846
71 Ga0373953_0059861 3300035117 Bacteria 1555
72 Ga0373954_0038229 3300035118 Bacteria 2232
73 Ga0373957_0049417 3300035120 Bacteria 1605
74 Ga0373924_0084193 3300035410 Unclassified 1355
75 Ga0373933_0020128 3300035724 Bacteria 3780
76 Ga0373937_0061239 3300036401 Bacteria 3459
77 Ga0395900_0001528 3300037418 Bacteria 27508
78 Ga0395900_0007322 3300037418 Bacteria 11416
79 Ga0395898_0001730 3300037466 Bacteria 28869
80 Ga0395898_0009894 3300037466 Bacteria 9998
81 Ga0395898_0495742 3300037466 Bacteria 1162
82 Ga0395905_0007732 3300037471 Bacteria 10666
83 Ga0436364_0064690 3300037853 Bacteria 4348
84 Ga0436364_0369788 3300037853 Bacteria 17230
85 Ga0436364_0571490 3300037853 Bacteria 4084
86 Ga0436364_0912872 3300037853 Bacteria 2325
87 Ga0436364_0923697 3300037853 Bacteria 1192
88 Ga0436364_1537762 3300037853 Bacteria 3296
89 Ga0436365_0054534 3300039437 Bacteria 2115
90 Ga0436365_0150453 3300039437 Bacteria 18403
91 Ga0436365_0320150 3300039437 Bacteria 36179
92 Ga0436365_0450740 3300039437 Bacteria 1904
93 Ga0436365_0630544 3300039437 Bacteria 5208
94 Ga0436365_1384448 3300039437 Bacteria 1598
95 Ga0436365_1728025 3300039437 Bacteria 1135
96 Ga0436365_1934562 3300039437 Bacteria 4297
97 Ga0436363_0438842 3300039450 Bacteria 2066
98 Ga0436363_1056223 3300039450 Bacteria 50291
99 Ga0436362_0126253 3300039453 Bacteria 2999
100 Ga0436362_0327514 3300039453 Bacteria 41506
101 Ga0439460_0094582 3300042461 Bacteria 953
102 Ga0466965_0219487 3300044683 Bacteria 1013
103 Ga0466964_0136104 3300044706 Bacteria 1124
104 Ga0466968_0221125 3300044735 Bacteria 892
105 Ga0466968_0236984 3300044735 Bacteria 863
106 Ga0466960_0184373 3300044901 Bacteria 1133
107 Ga0466959_0024722 3300045049 Bacteria 4450
108 Ga0466959_0237237 3300045049 Bacteria 1261
109 Ga0466958_0029440 3300045836 Bacteria 3259
110 Ga0466967_0013262 3300045976 Bacteria 6358
111 Ga0466967_0053910 3300045976 Bacteria 3536
112 Ga0466967_0075491 3300045976 Bacteria 3029
113 Ga0466967_0106944 3300045976 Bacteria 2565
114 Ga0466967_0178252 3300045976 Bacteria 2003
115 Ga0466967_0512681 3300045976 Bacteria 1178
116 Ga0466967_0571520 3300045976 Bacteria 1114
117 Ga0466967_0710178 3300045976 Bacteria 996
118 Ga0466967_0712191 3300045976 Bacteria 994
119 Ga0466967_0823167 3300045976 Bacteria 922
120 Ga0495592_0066206 3300046454 Bacteria 2644
121 Ga0495651_0003759 3300046462 Bacteria 11612
122 Ga0495653_0093419 3300046463 Bacteria 2194
123 Ga0495608_0007844 3300046511 Bacteria 7505
124 Ga0495628_0019433 3300046516 Bacteria 5617
125 Ga0495652_0224286 3300046529 Bacteria 1410
126 Ga0495640_0048420 3300046533 Bacteria 2937
127 Ga0495587_0023047 3300046536 Bacteria 3829
128 Ga0495667_0009953 3300046559 Bacteria 6439
129 Ga0495657_0003745 3300046675 Bacteria 12307
130 Ga0495623_0013905 3300046679 Bacteria 5218
131 Ga0495646_0004977 3300046680 Bacteria 8391
132 Ga0495613_0047592 3300046689 Bacteria 3168
133 Ga0495600_0011167 3300046809 Bacteria 5592
134 Ga0495604_0002122 3300047317 Bacteria 15964
135 Ga0495674_0019502 3300047319 Bacteria 6291
136 Ga0495680_0004847 3300047322 Bacteria 12760
137 Ga0495675_0056623 3300047444 Bacteria 2486
138 Ga0495684_0037012 3300047471 Bacteria 3741
139 Ga0495593_0102185 3300047673 Bacteria 1470
140 Ga0495602_0048914 3300048088 Bacteria 3793
141 Ga0496100_0169498 3300048903 Bacteria 1571
142 Ga0496101_0133344 3300048904 Bacteria 1888
143 Ga0496101_0375252 3300048904 Unclassified 1119
144 Ga0496104_0004779 3300048907 Bacteria 11796
145 Ga0496104_0103234 3300048907 Bacteria 2731
146 Ga0496104_0330194 3300048907 Bacteria 1438
147 Ga0496105_0038369 3300048908 Bacteria 3946
148 Ga0496109_0113161 3300048912 Bacteria 2524
149 Ga0496109_0121492 3300048912 Bacteria 2434
150 Ga0496112_0092119 3300048915 Bacteria 3000
151 Ga0496112_0114616 3300048915 Bacteria 2666
152 Ga0496112_0340737 3300048915 Bacteria 1443
153 Ga0501036_0056949 3300049572 Bacteria 3311
154 Ga0501038_0029714 3300049574 Bacteria 4840
155 Ga0501039_0171667 3300049575 Bacteria 1705
156 Ga0501041_0024592 3300049577 Bacteria 3617
157 Ga0501042_0026838 3300049578 Bacteria 4046
158 Ga0501067_0143660 3300049583 Bacteria 1329
159 Ga0501069_0291689 3300049585 Bacteria 956
160 Ga0501071_0014010 3300049587 Bacteria 5479
161 Ga0501075_0070774 3300049591 Bacteria 2636
162 Ga0501076_0014243 3300049592 Bacteria 5986
163 Ga0501077_0071803 3300049593 Bacteria 2194
164 nmdc:mga00v17_62403_c1 3300050491 Bacteria 2293
165 nmdc:mga05p37_146402_c1 3300050507 Bacteria 2892
166 nmdc:mga08y16_530329_c1 3300050511 Bacteria 1193
167 Ga0495595_0014341 3300053084 Bacteria 3360
168 Ga0495619_0002285 3300053085 Bacteria 12638
169 Ga0501082_0024843 3300060353 Bacteria 5164
170 Ga0466962_0013578 3300061719 Bacteria 3922
171 Ga0530510_0119748 3300061734 Bacteria 1932
172 Ga0501031_0025488
173 JGI25407J50210_10011884
174 Ga0070683_100224842
175 Ga0070660_100093042
176 Ga0070669_100079440
177 Ga0070675_100695638
178 Ga0070674_100107569
179 Ga0070674_100316331
180 Ga0070709_10209531
181 Ga0070714_100114274
182 Ga0070713_100150028
183 Ga0070713_100457544
184 Ga0070701_10171053
185 Ga0070711_100026780
186 Ga0070662_100064039
187 Ga0068867_100163716
188 Ga0070698_100024441
189 Ga0068855_100150129
190 Ga0070664_100207842
191 Ga0068857_100329664
192 Ga0068856_100011393
193 Ga0081538_10000068
194 Ga0081538_10008026
195 Ga0081540_1025177
196 Ga0081539_10011061
197 Ga0081539_10012636
198 Ga0070717_10017466
199 Ga0075364_10142408
200 Ga0070712_100003175
201 Ga0075367_10317804
202 Ga0075369_10057414
203 Ga0105245_10924335
204 Ga0114129_10155908
205 Ga0157375_10500482
206 Ga0157375_10652911
207 Ga0213873_10008519
208 Ga0213874_10001585
209 Ga0213876_10001600
210 Ga0213876_10002546
211 Ga0213876_10018131
212 Ga0213876_10212959
213 Ga0213875_10007060
214 Ga0213875_10072989
215 Ga0207688_10247466
216 Ga0207693_10000696
217 Ga0207663_10003405
218 Ga0207659_10173493
219 Ga0207659_10410655
220 Ga0207664_10017967
221 Ga0207706_10062364
222 Ga0207709_10042282
223 Ga0207669_10090091
224 Ga0207665_10243332
225 Ga0207689_10136578
226 Ga0207661_10304231
227 Ga0207679_10069366
228 Ga0207679_10074443
229 Ga0207640_10130743
230 Ga0207708_10003757
231 Ga0207702_10012544
232 Ga0207648_10031556
233 Ga0207648_10386102
234 Ga0207675_100420833
235 Ga0307405_10141389
236 Ga0307413_10046756
237 Ga0307410_10149006
238 Ga0307406_10254226
239 Ga0307407_10025112
240 Ga0307409_100290409
241 Ga0307409_101020497
242 Ga0373953_0059861
243 Ga0373954_0038229
244 Ga0373957_0049417
245 Ga0373924_0084193
246 Ga0373933_0020128
247 Ga0373937_0061239
248 Ga0395900_0001528
249 Ga0395900_0007322
250 Ga0395898_0001730
251 Ga0395898_0009894
252 Ga0395898_0495742
253 Ga0395905_0007732
254 Ga0436364_0064690
255 Ga0436364_0369788
256 Ga0436364_0571490
257 Ga0436364_0912872
258 Ga0436364_0923697
259 Ga0436364_1537762
260 Ga0436365_0054534
261 Ga0436365_0150453
262 Ga0436365_0320150
263 Ga0436365_0450740
264 Ga0436365_0630544
265 Ga0436365_1384448
266 Ga0436365_1728025
267 Ga0436365_1934562
268 Ga0436363_0438842
269 Ga0436363_1056223
270 Ga0436362_0126253
271 Ga0436362_0327514
272 Ga0439460_0094582
273 Ga0466965_0219487
274 Ga0466964_0136104
275 Ga0466968_0221125
276 Ga0466968_0236984
277 Ga0466960_0184373
278 Ga0466959_0024722
279 Ga0466959_0237237
280 Ga0466958_0029440
281 Ga0466967_0013262
282 Ga0466967_0053910
283 Ga0466967_0075491
284 Ga0466967_0106944
285 Ga0466967_0178252
286 Ga0466967_0512681
287 Ga0466967_0571520
288 Ga0466967_0710178
289 Ga0466967_0712191
290 Ga0466967_0823167
291 Ga0495592_0066206
292 Ga0495651_0003759
293 Ga0495653_0093419
294 Ga0495608_0007844
295 Ga0495628_0019433
296 Ga0495652_0224286
297 Ga0495640_0048420
298 Ga0495587_0023047
299 Ga0495667_0009953
300 Ga0495657_0003745
301 Ga0495623_0013905
302 Ga0495646_0004977
303 Ga0495613_0047592
304 Ga0495600_0011167
305 Ga0495604_0002122
306 Ga0495674_0019502
307 Ga0495680_0004847
308 Ga0495675_0056623
309 Ga0495684_0037012
310 Ga0495593_0102185
311 Ga0495602_0048914
312 Ga0496100_0169498
313 Ga0496101_0133344
314 Ga0496101_0375252
315 Ga0496104_0004779
316 Ga0496104_0103234
317 Ga0496104_0330194
318 Ga0496105_0038369
319 Ga0496109_0113161
320 Ga0496109_0121492
321 Ga0496112_0092119
322 Ga0496112_0114616
323 Ga0496112_0340737
324 Ga0501036_0056949
325 Ga0501038_0029714
326 Ga0501039_0171667
327 Ga0501041_0024592
328 Ga0501042_0026838
329 Ga0501067_0143660
330 Ga0501069_0291689
331 Ga0501071_0014010
332 Ga0501075_0070774
333 Ga0501076_0014243
334 Ga0501077_0071803
335 nmdc:mga00v17_62403_c1
336 nmdc:mga05p37_146402_c1
337 nmdc:mga08y16_530329_c1
338 Ga0495595_0014341
339 Ga0495619_0002285
340 Ga0501082_0024843
341 Ga0466962_0013578
342 Ga0530510_0119748

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

31

144

0.95

PF18029

Glyoxalase_6

Glyoxalase-like domain

165

286

0.79

PF18029

Glyoxalase_6

Glyoxalase-like domain

31

145

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oxh-assembly1.cif.gz_A mycobacterium tuberculosis kinase inhibitor homolog rv0577 0.9465 1 271
3oxh-assembly1.cif.gz_A mycobacterium tuberculosis kinase inhibitor homolog rv0577 0.9099 1 271
4am0-assembly1.cif.gz_S structure of dengue virus strain 4 diii in complex with fab 2h12 0.7731 96 120
2r6u-assembly2.cif.gz_D crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.7659 5 128
5zbd-assembly1.cif.gz_B crystal structure of tryptophan oxidase (c395a mutant) from chromobacterium violaceum 0.759 95 126
ID Description Score Start End Superfamily
3oxhA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9271 8 128 3.10.180.10
3oxhA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9163 1 135 3.10.180.10
af_I6XA34_8_128_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9052 8 130 3.10.180.10
3oxhA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9041 8 128 3.10.180.10
af_I6XA34_8_128_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8981 8 130 3.10.180.10
ID Description Score Start End GO Terms
AF-F9UAX5-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9624 1 270 GO:0051213
AF-A0A0M8SLU6-F1-model_v4 VOC domain-containing protein 0.9604 8 271
AF-A0A6N7Z7I3-F1-model_v4 VOC family protein 0.9597 3 271
AF-A0A7J4ZZR6-F1-model_v4 VOC family protein 0.9596 7 244
AF-A0A536PG82-F1-model_v4 VOC family protein 0.959 1 268

Map