F259492

General Info

Members Datasets Scaffolds Average Seq Length
171 113 342 234

Family's Representative Sequence

Representative Sequence 3300048927|Ga0496124_0105793|Ga0496124_0105793_635_1396
Length 253
Sequence MTKPSPEIEQLAAQRLAADEDRLSKFVGAGQAKRRQSLSLGGAWREFWKHPSPWMIASFLLGSVAARVAVGGGSWWELLVPIALVALFPVIEWVIHVAILHWRPRSLGPVRVDSRLARDHRAHHVDPRDLPLVFIPWKALLWLLPTYVVVAWLAMPGWPAALSLLVSVYAIKFGYEWTHYLVHSDYRPRTRWFRSVWRNHRLHHYKNEHYWFTVTSAGTADRLFGTYPADPSAVPTSPTVRDLHDLEAERARA

Samples

Sample ID Description Type Environment
1 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
2 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
13 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
14 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
59 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
60 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
61 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
62 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
63 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
64 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
65 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
66 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
67 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
68 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
69 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
70 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
71 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
72 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
73 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
74 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
75 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
76 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
77 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
78 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
79 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
80 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
81 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
82 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
83 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
84 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
85 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
86 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
87 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
88 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
89 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
93 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
94 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
95 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
96 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
97 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
98 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
99 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
100 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
101 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
102 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
103 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
104 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
105 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
106 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
107 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
108 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
109 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
110 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
111 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
112 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
113 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.83
Metatranscriptomes 0
Isolates 1.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.49
Nodule 0
Rhizoplane 10.53
Rhizosphere 58.48
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496124_0105793 3300048927 Bacteria 2273
2 Ga0055540_1000127 3300003792 Bacteria 77764
3 Ga0070658_10143539 3300005327 Bacteria 1995
4 Ga0070660_100060999 3300005339 Bacteria 2928
5 Ga0070687_100127869 3300005343 Bacteria 1463
6 Ga0070674_100098568 3300005356 Bacteria 2125
7 Ga0070667_100019366 3300005367 Bacteria 5646
8 Ga0070667_100476049 3300005367 Bacteria 1143
9 Ga0070678_100109928 3300005456 Bacteria 2155
10 Ga0070678_100569287 3300005456 Bacteria 1008
11 Ga0070685_10368276 3300005466 Bacteria 987
12 Ga0070685_10383655 3300005466 Bacteria 969
13 Ga0070684_100031603 3300005535 Bacteria 4508
14 Ga0068853_100009184 3300005539 Bacteria 7964
15 Ga0070672_100251139 3300005543 Bacteria 1490
16 Ga0070686_100027371 3300005544 Bacteria 3451
17 Ga0070693_100016647 3300005547 Bacteria 3809
18 Ga0070665_100726840 3300005548 Bacteria 1006
19 Ga0068857_100105523 3300005577 Bacteria 2530
20 Ga0068856_100438740 3300005614 Bacteria 1326
21 Ga0068852_100138748 3300005616 Bacteria 2248
22 Ga0068858_100222835 3300005842 Bacteria 1787
23 Ga0068860_100000169 3300005843 Bacteria 107281
24 Ga0068860_100211261 3300005843 Bacteria 1882
25 Ga0081455_10118040 3300005937 Bacteria 2095
26 Ga0075365_10009034 3300006038 Bacteria 5700
27 Ga0075365_10010801 3300006038 Bacteria 5338
28 Ga0075365_10034925 3300006038 Bacteria 3250
29 Ga0075365_10055912 3300006038 Bacteria 2622
30 Ga0075365_10076288 3300006038 Bacteria 2263
31 Ga0075365_10120920 3300006038 Bacteria 1806
32 Ga0075365_10132246 3300006038 Bacteria 1727
33 Ga0075365_10194075 3300006038 Bacteria 1421
34 Ga0075368_10073553 3300006042 Bacteria 1383
35 Ga0075363_100000540 3300006048 Bacteria 12242
36 Ga0075363_100050028 3300006048 Bacteria 2226
37 Ga0075363_100050101 3300006048 Bacteria 2224
38 Ga0075363_100062900 3300006048 Bacteria 2002
39 Ga0075363_100091959 3300006048 Bacteria 1670
40 Ga0075363_100254164 3300006048 Bacteria 1012
41 Ga0075364_10055746 3300006051 Bacteria 2586
42 Ga0075364_10057133 3300006051 Bacteria 2555
43 Ga0075364_10072859 3300006051 Bacteria 2264
44 Ga0075364_10204303 3300006051 Bacteria 1339
45 Ga0075367_10000700 3300006178 Bacteria 12914
46 Ga0075367_10201833 3300006178 Bacteria 1242
47 Ga0075367_10206177 3300006178 Bacteria 1229
48 Ga0075370_10036016 3300006353 Bacteria 2778
49 Ga0075370_10154164 3300006353 Bacteria 1347
50 Ga0075370_10189829 3300006353 Bacteria 1210
51 Ga0068865_100134376 3300006881 Bacteria 1857
52 Ga0105245_10077484 3300009098 Bacteria 3031
53 Ga0105247_10371008 3300009101 Bacteria 1012
54 Ga0105243_10034313 3300009148 Bacteria 3927
55 Ga0105243_10101044 3300009148 Bacteria 2394
56 Ga0105248_10313348 3300009177 Bacteria 1767
57 Ga0105239_10023722 3300010375 Bacteria 6754
58 Ga0105239_10391289 3300010375 Bacteria 1572
59 Ga0105246_10006424 3300011119 Bacteria 7185
60 Ga0157369_10821916 3300013105 Bacteria 954
61 Ga0163162_10124144 3300013306 Bacteria 2687
62 Ga0157372_10023613 3300013307 Bacteria 6671
63 Ga0157375_10037618 3300013308 Bacteria 4638
64 Ga0157375_11555551 3300013308 Bacteria 781
65 Ga0163163_10021279 3300014325 Bacteria 6118
66 Ga0163163_11157832 3300014325 Bacteria 836
67 Ga0157379_10021068 3300014968 Bacteria 5769
68 Ga0209051_1000014 3300025303 Bacteria 552732
69 Ga0207647_10058889 3300025904 Bacteria 2351
70 Ga0207705_10147907 3300025909 Bacteria 1758
71 Ga0207657_10077885 3300025919 Bacteria 2793
72 Ga0207687_10163602 3300025927 Bacteria 1710
73 Ga0207644_10657014 3300025931 Bacteria 873
74 Ga0207704_10553252 3300025938 Bacteria 935
75 Ga0207691_10206778 3300025940 Bacteria 1707
76 Ga0207711_10737409 3300025941 Bacteria 918
77 Ga0207661_10010538 3300025944 Bacteria 6658
78 Ga0207658_10191493 3300025986 Bacteria 1700
79 Ga0207703_10285050 3300026035 Bacteria 1501
80 Ga0207674_10126276 3300026116 Bacteria 2524
81 Ga0207675_100029701 3300026118 Bacteria 5091
82 Ga0207683_10033913 3300026121 Bacteria 4435
83 Ga0268266_10016571 3300028379 Bacteria 6296
84 Ga0268264_10919610 3300028381 Bacteria 879
85 Ga0265327_10000118 3300031251 Bacteria 172792
86 Ga0265327_10003458 3300031251 Bacteria 15044
87 Ga0265327_10015648 3300031251 Bacteria 4879
88 Ga0307513_10188759 3300031456 Bacteria 1915
89 Ga0307413_10022326 3300031824 Bacteria 3408
90 Ga0307413_10203576 3300031824 Bacteria 1431
91 Ga0307416_100302928 3300032002 Bacteria 1590
92 Ga0307411_10533012 3300032005 Bacteria 999
93 Ga0307415_100238945 3300032126 Bacteria 1468
94 Ga0451789_1224618 3300041443 Bacteria 1660
95 Ga0451839_1157537 3300041496 Bacteria 786
96 Ga0451853_0627093 3300041512 Bacteria 1018
97 Ga0439448_0008815 3300042005 Bacteria 2959
98 Ga0450907_003636 3300042146 Bacteria 2726
99 Ga0466960_0036670 3300044901 Bacteria 2297
100 Ga0495639_0298597 3300046475 Bacteria 803
101 Ga0495606_0001050 3300046507 Bacteria 39881
102 Ga0495668_0002375 3300046616 Bacteria 15634
103 Ga0495625_0010570 3300046660 Bacteria 7621
104 Ga0495658_0220871 3300046683 Bacteria 1186
105 Ga0495683_0038639 3300047323 Bacteria 2416
106 Ga0495626_0009002 3300048091 Bacteria 5413
107 Ga0496101_0307430 3300048904 Bacteria 1242
108 Ga0496102_0020171 3300048905 Bacteria 5886
109 Ga0496103_0141831 3300048906 Bacteria 1537
110 Ga0496105_0292610 3300048908 Bacteria 1311
111 Ga0496106_0220090 3300048909 Bacteria 1514
112 Ga0496107_0152126 3300048910 Bacteria 1712
113 Ga0496107_0287066 3300048910 Bacteria 1225
114 Ga0496108_0122418 3300048911 Bacteria 2232
115 Ga0496109_0037968 3300048912 Bacteria 4353
116 Ga0496109_0062944 3300048912 Bacteria 3393
117 Ga0496109_0113621 3300048912 Bacteria 2519
118 Ga0496110_0117106 3300048913 Bacteria 2399
119 Ga0496111_0055807 3300048914 Bacteria 2857
120 Ga0496111_0108389 3300048914 Bacteria 2045
121 Ga0496112_0690708 3300048915 Bacteria 949
122 Ga0496114_0011867 3300048917 Bacteria 6973
123 Ga0496114_0046488 3300048917 Bacteria 3607
124 Ga0501034_0195501 3300049571 Bacteria 1983
125 Ga0501037_0325209 3300049573 Bacteria 1064
126 Ga0501047_0127410 3300049581 Bacteria 2426
127 Ga0501067_0000854 3300049583 Bacteria 16431
128 Ga0501068_0005396 3300049584 Bacteria 6991
129 Ga0501068_0159855 3300049584 Bacteria 1420
130 Ga0501069_0220981 3300049585 Bacteria 1101
131 Ga0501070_0013678 3300049586 Bacteria 6836
132 Ga0501070_0035870 3300049586 Bacteria 4141
133 Ga0501071_0009022 3300049587 Bacteria 6620
134 Ga0501071_0161715 3300049587 Bacteria 1674
135 Ga0501073_0005220 3300049589 Bacteria 9741
136 Ga0501073_0019750 3300049589 Bacteria 4863
137 Ga0501074_0000749 3300049590 Bacteria 20420
138 Ga0501074_0028189 3300049590 Bacteria 4069
139 Ga0501074_0274576 3300049590 Bacteria 1198
140 Ga0501076_0523107 3300049592 Bacteria 978
141 Ga0501077_0029665 3300049593 Bacteria 3478
142 Ga0501080_0022624 3300049742 Bacteria 5822
143 Ga0501080_0124017 3300049742 Bacteria 2393
144 Ga0501080_0231306 3300049742 Bacteria 1690
145 Ga0501080_0303944 3300049742 Bacteria 1446
146 nmdc:mga03683_187929_c1 3300050489 Bacteria 944
147 nmdc:mga03683_89402_c1 3300050489 Bacteria 1341
148 nmdc:mga03683_96128_c1 3300050489 Bacteria 1297
149 nmdc:mga03n38_36917_c1 3300050490 Bacteria 2104
150 nmdc:mga03n38_67590_c2 3300050490 Bacteria 1016
151 nmdc:mga00v17_38537_c1 3300050491 Bacteria 2858
152 nmdc:mga00v17_49257_c1 3300050491 Bacteria 2555
153 nmdc:mga0yw44_22871_c1 3300050492 Bacteria 3513
154 nmdc:mga0yw44_266347_c1 3300050492 Bacteria 1143
155 nmdc:mga0yw44_305684_c1 3300050492 Bacteria 1066
156 nmdc:mga0yw44_3091_c1 3300050492 Bacteria 7292
157 nmdc:mga0yw44_5808_c1 3300050492 Bacteria 5885
158 nmdc:mga0yw44_77198_c1 3300050492 Bacteria 2080
159 nmdc:mga0yw44_78094_c1 3300050492 Bacteria 2070
160 nmdc:mga06z11_1877_c1 3300050494 Bacteria 7919
161 nmdc:mga06z11_93386_c1 3300050494 Bacteria 1638
162 nmdc:mga07m45_133112_c1 3300050496 Bacteria 1439
163 nmdc:mga07m45_59754_c1 3300050496 Bacteria 2157
164 Ga0500644_0000034 3300053088 Bacteria 83176
165 Ga0500641_0160818 3300053096 Bacteria 968
166 Ga0501084_0013567 3300054114 Bacteria 6741
167 Ga0501082_0062223 3300060353 Bacteria 3212
168 Ga0501082_0078952 3300060353 Bacteria 2839
169 Ga0501082_0171157 3300060353 Bacteria 1888
170 2753038881 2751185725 Bacteria 5740550
171 2753327529 2751185792 Bacteria 5739090
172 Ga0496124_0105793
173 Ga0055540_1000127
174 Ga0070658_10143539
175 Ga0070660_100060999
176 Ga0070687_100127869
177 Ga0070674_100098568
178 Ga0070667_100019366
179 Ga0070667_100476049
180 Ga0070678_100109928
181 Ga0070678_100569287
182 Ga0070685_10368276
183 Ga0070685_10383655
184 Ga0070684_100031603
185 Ga0068853_100009184
186 Ga0070672_100251139
187 Ga0070686_100027371
188 Ga0070693_100016647
189 Ga0070665_100726840
190 Ga0068857_100105523
191 Ga0068856_100438740
192 Ga0068852_100138748
193 Ga0068858_100222835
194 Ga0068860_100000169
195 Ga0068860_100211261
196 Ga0081455_10118040
197 Ga0075365_10009034
198 Ga0075365_10010801
199 Ga0075365_10034925
200 Ga0075365_10055912
201 Ga0075365_10076288
202 Ga0075365_10120920
203 Ga0075365_10132246
204 Ga0075365_10194075
205 Ga0075368_10073553
206 Ga0075363_100000540
207 Ga0075363_100050028
208 Ga0075363_100050101
209 Ga0075363_100062900
210 Ga0075363_100091959
211 Ga0075363_100254164
212 Ga0075364_10055746
213 Ga0075364_10057133
214 Ga0075364_10072859
215 Ga0075364_10204303
216 Ga0075367_10000700
217 Ga0075367_10201833
218 Ga0075367_10206177
219 Ga0075370_10036016
220 Ga0075370_10154164
221 Ga0075370_10189829
222 Ga0068865_100134376
223 Ga0105245_10077484
224 Ga0105247_10371008
225 Ga0105243_10034313
226 Ga0105243_10101044
227 Ga0105248_10313348
228 Ga0105239_10023722
229 Ga0105239_10391289
230 Ga0105246_10006424
231 Ga0157369_10821916
232 Ga0163162_10124144
233 Ga0157372_10023613
234 Ga0157375_10037618
235 Ga0157375_11555551
236 Ga0163163_10021279
237 Ga0163163_11157832
238 Ga0157379_10021068
239 Ga0209051_1000014
240 Ga0207647_10058889
241 Ga0207705_10147907
242 Ga0207657_10077885
243 Ga0207687_10163602
244 Ga0207644_10657014
245 Ga0207704_10553252
246 Ga0207691_10206778
247 Ga0207711_10737409
248 Ga0207661_10010538
249 Ga0207658_10191493
250 Ga0207703_10285050
251 Ga0207674_10126276
252 Ga0207675_100029701
253 Ga0207683_10033913
254 Ga0268266_10016571
255 Ga0268264_10919610
256 Ga0265327_10000118
257 Ga0265327_10003458
258 Ga0265327_10015648
259 Ga0307513_10188759
260 Ga0307413_10022326
261 Ga0307413_10203576
262 Ga0307416_100302928
263 Ga0307411_10533012
264 Ga0307415_100238945
265 Ga0451789_1224618
266 Ga0451839_1157537
267 Ga0451853_0627093
268 Ga0439448_0008815
269 Ga0450907_003636
270 Ga0466960_0036670
271 Ga0495639_0298597
272 Ga0495606_0001050
273 Ga0495668_0002375
274 Ga0495625_0010570
275 Ga0495658_0220871
276 Ga0495683_0038639
277 Ga0495626_0009002
278 Ga0496101_0307430
279 Ga0496102_0020171
280 Ga0496103_0141831
281 Ga0496105_0292610
282 Ga0496106_0220090
283 Ga0496107_0152126
284 Ga0496107_0287066
285 Ga0496108_0122418
286 Ga0496109_0037968
287 Ga0496109_0062944
288 Ga0496109_0113621
289 Ga0496110_0117106
290 Ga0496111_0055807
291 Ga0496111_0108389
292 Ga0496112_0690708
293 Ga0496114_0011867
294 Ga0496114_0046488
295 Ga0501034_0195501
296 Ga0501037_0325209
297 Ga0501047_0127410
298 Ga0501067_0000854
299 Ga0501068_0005396
300 Ga0501068_0159855
301 Ga0501069_0220981
302 Ga0501070_0013678
303 Ga0501070_0035870
304 Ga0501071_0009022
305 Ga0501071_0161715
306 Ga0501073_0005220
307 Ga0501073_0019750
308 Ga0501074_0000749
309 Ga0501074_0028189
310 Ga0501074_0274576
311 Ga0501076_0523107
312 Ga0501077_0029665
313 Ga0501080_0022624
314 Ga0501080_0124017
315 Ga0501080_0231306
316 Ga0501080_0303944
317 nmdc:mga03683_187929_c1
318 nmdc:mga03683_89402_c1
319 nmdc:mga03683_96128_c1
320 nmdc:mga03n38_36917_c1
321 nmdc:mga03n38_67590_c2
322 nmdc:mga00v17_38537_c1
323 nmdc:mga00v17_49257_c1
324 nmdc:mga0yw44_22871_c1
325 nmdc:mga0yw44_266347_c1
326 nmdc:mga0yw44_305684_c1
327 nmdc:mga0yw44_3091_c1
328 nmdc:mga0yw44_5808_c1
329 nmdc:mga0yw44_77198_c1
330 nmdc:mga0yw44_78094_c1
331 nmdc:mga06z11_1877_c1
332 nmdc:mga06z11_93386_c1
333 nmdc:mga07m45_133112_c1
334 nmdc:mga07m45_59754_c1
335 Ga0500644_0000034
336 Ga0500641_0160818
337 Ga0501084_0013567
338 Ga0501082_0062223
339 Ga0501082_0078952
340 Ga0501082_0171157
341 2753038881
342 2753327529

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04116

FA_hydroxylase

Fatty acid hydroxylase

81

226

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zr0-assembly1.cif.gz_A full length scs7p (only hydroxylase domain visible) 0.6889 22 207
4zr0-assembly1.cif.gz_A full length scs7p (only hydroxylase domain visible) 0.5497 22 207
7zc6-assembly1.cif.gz_A na+ - translocating ferredoxin: nad+ reductase (rnf) of c. tetanomorphum 0.3102 18 177
7vcf-assembly1.cif.gz_W cryo-em structure of chlamydomonas toc-tic supercomplex 0.3058 11 184
8glv-assembly1.cif.gz_Me 96-nm repeat unit of doublet microtubules from chlamydomonas reinhardtii flagella 0.3015 16 186
ID Description Score Start End Superfamily
af_G5EEW0_732_899_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.3456 31 161 1.20.1640.10
af_A4I8Z5_101_293_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.345 1 185 1.20.1250.20
af_Q9GUB6_24_328_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3427 50 182 1.20.1070.10
af_A0A1D6PYC4_373_583_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3275 11 205 1.20.1250.20
af_Q6T3U3_590_806_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.3229 31 182 1.20.1640.10
ID Description Score Start End GO Terms
AF-A0A831ZMK6-F1-model_v4 deleted 0.8949 12 170
AF-X7ZTS3-F1-model_v4 deleted 0.8707 31 129
AF-A0A2E5WLA8-F1-model_v4 Fatty acid hydroxylase domain-containing protein 0.8402 14 206 GO:0005506
GO:0008610
GO:0016020
GO:0016491
AF-A0A370I8A5-F1-model_v4 Fatty acid hydroxylase family protein 0.8268 9 224 GO:0005506
GO:0008610
GO:0016020
GO:0016491
AF-A0A2E6VPB9-F1-model_v4 Fatty acid hydroxylase domain-containing protein 0.8262 15 218 GO:0005506
GO:0008610
GO:0016020
GO:0016491

Map