F259135

General Info

Members Datasets Scaffolds Average Seq Length
171 118 342 395

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0008931|Ga0395899_0008931_5278_6546
Length 422
Sequence MTSRASSRLDLVLQLAVVALVGLNLRPFITGVGPLAADLSAQSGLGLQGMAMLTLVPMLLMGCFAFAGPFLQARVGARRAVIVALAVLGLASFLRLFVSTGAQIVATAALLGFGAAIVQAVFPGIVKQQFPRHVGMVMGLYSAMLMGGGAVGAQASPIVADLFGNWRAGLAWMAVPALAAMILAACYLRRDGVGRQGGTSAVSFLRRPRTWLLMACFGLVNGGYSTVVAWLAPSYQEHGWTGAASGSLLAIMALCQAVAALLLPTLARGSNDLRPWLWLTLAMQAAGFAGLALWPEAAPIVWAILLGAGLGGCFALSMIVALDHLPDPTQAGALSALMQGGGFLIAAIPPWIIAVLHDITGSFLAGWVLHLICIAVVTVLYWRVDPRGYEQAMTPSSPEHDGDKVGGNGVGSDRLMRSEVAI

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
9 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
13 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
14 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
15 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
16 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
17 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
18 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
19 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
20 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
21 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
22 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
23 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
24 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
25 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
26 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
27 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
29 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
30 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
31 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
33 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
34 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
35 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
36 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
37 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
38 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
48 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
49 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
50 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
51 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
52 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
53 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
54 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
55 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
56 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
57 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
58 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
59 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
60 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
61 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
62 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
63 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
64 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
65 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
66 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
67 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
69 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
70 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
80 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
81 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
82 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
83 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
84 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
85 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
86 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
89 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
90 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
91 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
92 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
93 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
94 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
95 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
96 2643221618 Ensifer sp. Root231 Isolate Unclassified
97 2643221626 Ensifer sp. Root31 Isolate Unclassified
98 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
99 2643221655 Ensifer sp. Root1252 Isolate Unclassified
100 2643221659 Ensifer sp. Root127 Isolate Unclassified
101 2643221698 Ensifer sp. Root142 Isolate Unclassified
102 2643221712 Ensifer sp. Root258 Isolate Unclassified
103 2643221718 Rhizobium sp. Root268 Isolate Unclassified
104 2643221723 Ensifer sp. Root278 Isolate Unclassified
105 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
106 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
107 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
108 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
109 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
110 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
111 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
112 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
113 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
114 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
115 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
116 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
117 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
118 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.63
Metatranscriptomes 0
Isolates 16.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.2
Nodule 3.51
Rhizoplane 0.58
Rhizosphere 69.59
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0008931 3300037312 Bacteria 7714
2 JGI25162J39368_1000111 3300002737 Bacteria 89317
3 JGI25159J45721_1000024 3300002987 Bacteria 116245
4 JGI25165J46597_1000070 3300003214 Bacteria 193557
5 JGI25160J50197_1000063 3300003354 Bacteria 116245
6 Ga0055526_1000541 3300003771 Bacteria 29823
7 Ga0055526_1005378 3300003771 Bacteria 7377
8 Ga0055524_1000011 3300003775 Bacteria 261442
9 Ga0058692_1000010 3300003856 Bacteria 326761
10 Ga0055543_1000124 3300004625 Bacteria 63936
11 Ga0065165_1000163 3300005262 Bacteria 116283
12 Ga0070663_100013889 3300005455 Bacteria 5152
13 Ga0068857_100050481 3300005577 Bacteria 3690
14 Ga0068854_100028644 3300005578 Bacteria 3851
15 Ga0105244_10009492 3300009036 Bacteria 5978
16 Ga0105250_10008840 3300009092 Bacteria 4262
17 Ga0105240_10000739 3300009093 Bacteria 59740
18 Ga0105240_10120343 3300009093 Bacteria 3162
19 Ga0105240_10122001 3300009093 Bacteria 3137
20 Ga0105241_10029641 3300009174 Bacteria 4085
21 Ga0105237_10002121 3300009545 Bacteria 25037
22 Ga0105237_10021656 3300009545 Bacteria 6608
23 Ga0105238_10032329 3300009551 Bacteria 5323
24 Ga0105238_10061034 3300009551 Bacteria 3774
25 Ga0105239_10000454 3300010375 Bacteria 59740
26 Ga0157373_10018501 3300013100 Bacteria 5072
27 Ga0157371_10017730 3300013102 Bacteria 5283
28 Ga0171463_1005 3300013249 Bacteria 358236
29 Ga0183363_1090 3300015690 Bacteria 27043
30 Ga0209760_100795 3300025207 Bacteria 4333
31 Ga0209436_102817 3300025208 Bacteria 4941
32 Ga0209672_101702 3300025228 Bacteria 7089
33 Ga0207427_106353 3300025231 Bacteria 1508
34 Ga0209437_100064 3300025233 Bacteria 334360
35 Ga0209233_1000081 3300025261 Bacteria 336832
36 Ga0209233_1000131 3300025261 Bacteria 205257
37 Ga0209455_1003321 3300025272 Bacteria 5763
38 Ga0209130_1000138 3300025284 Bacteria 116297
39 Ga0209675_1000596 3300025291 Bacteria 25925
40 Ga0209025_1001231 3300025294 Bacteria 35703
41 Ga0209564_1000250 3300025295 Bacteria 114790
42 Ga0209564_1000369 3300025295 Bacteria 83878
43 Ga0209256_1000317 3300025299 Bacteria 83179
44 Ga0207426_1000255 3300025302 Bacteria 116297
45 Ga0209257_1011682 3300025304 Bacteria 4187
46 Ga0207696_1007558 3300025711 Bacteria 4240
47 Ga0207655_1014101 3300025728 Bacteria 4539
48 Ga0207695_10000788 3300025913 Bacteria 59670
49 Ga0207671_10000411 3300025914 Bacteria 59718
50 Ga0207671_10044338 3300025914 Bacteria 3289
51 Ga0207694_10019258 3300025924 Bacteria 5159
52 Ga0207640_10009624 3300025981 Bacteria 5419
53 Ga0207678_10045408 3300026067 Bacteria 3799
54 Ga0207674_10066657 3300026116 Bacteria 3626
55 Ga0209371_1000006 3300027312 Bacteria 1055642
56 Ga0268256_1000007 3300030500 Bacteria 1055326
57 Ga0307408_100000563 3300031548 Bacteria 31982
58 Ga0395899_0158412 3300037312 Bacteria 1601
59 Ga0395900_0091341 3300037418 Bacteria 3129
60 Ga0395898_0210904 3300037466 Bacteria 1853
61 Ga0395905_0332699 3300037471 Bacteria 1409
62 Ga0237819_00847 3300038705 Bacteria 9639
63 Ga0439432_017466 3300042006 Bacteria 2407
64 Ga0450904_000366 3300042139 Bacteria 9499
65 Ga0466972_0009916 3300044658 Bacteria 4781
66 Ga0495607_0017794 3300046501 Bacteria 4550
67 Ga0495632_0012840 3300046519 Bacteria 4805
68 Ga0495632_0049891 3300046519 Bacteria 2066
69 Ga0495643_0008500 3300046522 Bacteria 6492
70 Ga0495663_0003532 3300046525 Bacteria 4501
71 Ga0495654_0020142 3300046530 Bacteria 3479
72 Ga0495633_0013205 3300046558 Bacteria 4361
73 Ga0495661_0021165 3300046665 Bacteria 4242
74 Ga0496116_0057197 3300048919 Bacteria 2551
75 Ga0496122_0045811 3300048925 Bacteria 3394
76 Ga0496123_0052369 3300048926 Bacteria 2709
77 Ga0501031_0002769 3300049568 Bacteria 11168
78 Ga0501031_0012439 3300049568 Bacteria 5552
79 Ga0501031_0114800 3300049568 Bacteria 1759
80 Ga0501032_0022038 3300049569 Bacteria 4422
81 Ga0501032_0028115 3300049569 Bacteria 3864
82 Ga0501032_0044529 3300049569 Bacteria 3003
83 Ga0501032_0090851 3300049569 Bacteria 2026
84 Ga0501033_0000446 3300049570 Bacteria 39481
85 Ga0501033_0003130 3300049570 Bacteria 13749
86 Ga0501033_0019827 3300049570 Bacteria 5083
87 Ga0501033_0029784 3300049570 Bacteria 4102
88 Ga0501033_0067051 3300049570 Bacteria 2639
89 Ga0501033_0083288 3300049570 Bacteria 2345
90 Ga0501033_0223763 3300049570 Bacteria 1338
91 Ga0501034_0004324 3300049571 Bacteria 15844
92 Ga0501034_0185096 3300049571 Bacteria 2047
93 Ga0501036_0005424 3300049572 Bacteria 10334
94 Ga0501036_0029074 3300049572 Bacteria 4672
95 Ga0501037_0000179 3300049573 Bacteria 58767
96 Ga0501037_0001481 3300049573 Bacteria 17182
97 Ga0501037_0077029 3300049573 Bacteria 2420
98 Ga0501037_0165894 3300049573 Bacteria 1573
99 Ga0501038_0026285 3300049574 Bacteria 5184
100 Ga0501038_0102463 3300049574 Bacteria 2382
101 Ga0501039_0001884 3300049575 Bacteria 15509
102 Ga0501042_0011846 3300049578 Bacteria 5889
103 Ga0501043_0000005 3300049579 Bacteria 254466
104 Ga0501043_0005191 3300049579 Bacteria 10540
105 Ga0501043_0008314 3300049579 Bacteria 8172
106 Ga0501046_0021898 3300049580 Bacteria 5269
107 Ga0501046_0049589 3300049580 Bacteria 3320
108 Ga0501047_0003716 3300049581 Bacteria 14368
109 Ga0501047_0043171 3300049581 Bacteria 4355
110 Ga0501047_0070774 3300049581 Bacteria 3358
111 Ga0501047_0114296 3300049581 Bacteria 2582
112 Ga0501047_0121847 3300049581 Bacteria 2489
113 Ga0501047_0292296 3300049581 Bacteria 1473
114 Ga0501068_0047823 3300049584 Bacteria 2581
115 Ga0501069_0000011 3300049585 Bacteria 153214
116 Ga0501069_0052286 3300049585 Bacteria 2274
117 Ga0501070_0001424 3300049586 Bacteria 21419
118 Ga0501070_0013988 3300049586 Bacteria 6756
119 Ga0501070_0047624 3300049586 Bacteria 3562
120 Ga0501070_0188915 3300049586 Bacteria 1694
121 Ga0501070_0292131 3300049586 Bacteria 1328
122 Ga0501073_0105441 3300049589 Bacteria 1956
123 Ga0501074_0000336 3300049590 Bacteria 27389
124 Ga0501080_0001369 3300049742 Bacteria 20402
125 Ga0501083_0000805 3300049744 Bacteria 20562
126 Ga0501035_0000107 3300049822 Bacteria 103130
127 Ga0501035_0007869 3300049822 Bacteria 9961
128 Ga0501035_0013853 3300049822 Bacteria 7443
129 Ga0501035_0015836 3300049822 Bacteria 6958
130 Ga0501035_0039263 3300049822 Bacteria 4284
131 Ga0501035_0060690 3300049822 Bacteria 3366
132 Ga0501044_0000154 3300049823 Bacteria 85407
133 Ga0501044_0005777 3300049823 Bacteria 13696
134 Ga0501044_0009552 3300049823 Bacteria 10560
135 Ga0501044_0026084 3300049823 Bacteria 6189
136 Ga0501044_0026244 3300049823 Bacteria 6168
137 Ga0501044_0151531 3300049823 Bacteria 2301
138 Ga0501044_0215300 3300049823 Bacteria 1874
139 Ga0501044_0279595 3300049823 Bacteria 1603
140 Ga0501045_0154331 3300049824 Bacteria 1708
141 Ga0501045_0320788 3300049824 Bacteria 1153
142 nmdc:mga03683_47509_c1 3300050489 Bacteria 1781
143 Ga0501082_0015310 3300060353 Bacteria 6603
144 2535517451 2534681796 Bacteria 7146037
145 2552747272 2551306352 Bacteria 3873115
146 2600196261 2599185352 Bacteria 7228948
147 2617381090 2617270742 Bacteria 6808054
148 2643772220 2643221550 Bacteria 4619371
149 2644106053 2643221618 Bacteria 7717186
150 2644146984 2643221626 Bacteria 8069654
151 2644208385 2643221637 Bacteria 5345260
152 2644310664 2643221655 Bacteria 7722067
153 2644334549 2643221659 Bacteria 7890716
154 2644545252 2643221698 Bacteria 7756764
155 2644616498 2643221712 Bacteria 7729434
156 2644651636 2643221718 Bacteria 5345506
157 2644673344 2643221723 Bacteria 7095460
158 2694634053 2693429783 Bacteria 7019804
159 2694638577 2693429784 Bacteria 7241525
160 2728749168 2728368998 Bacteria 8720350
161 2753461230 2751185821 Bacteria 6189929
162 2778176570 2775507266 Bacteria 7392367
163 2842484267 2842482326 Bacteria 7212537
164 2894025947 2894023352 Bacteria 5167372
165 2917702685 2917699015 Bacteria 7043791
166 2920822677 2920822456 Bacteria 6897201
167 2939631235 2939631187 Bacteria 6118131
168 2996338876 2996336353 Bacteria 5511628
169 8004642784 8004640170 Bacteria 6723001
170 8005546267 8005542996 Bacteria 7077758
171 8057101967 8057101203 Bacteria 5034064
172 Ga0395899_0008931
173 JGI25162J39368_1000111
174 JGI25159J45721_1000024
175 JGI25165J46597_1000070
176 JGI25160J50197_1000063
177 Ga0055526_1000541
178 Ga0055526_1005378
179 Ga0055524_1000011
180 Ga0058692_1000010
181 Ga0055543_1000124
182 Ga0065165_1000163
183 Ga0070663_100013889
184 Ga0068857_100050481
185 Ga0068854_100028644
186 Ga0105244_10009492
187 Ga0105250_10008840
188 Ga0105240_10000739
189 Ga0105240_10120343
190 Ga0105240_10122001
191 Ga0105241_10029641
192 Ga0105237_10002121
193 Ga0105237_10021656
194 Ga0105238_10032329
195 Ga0105238_10061034
196 Ga0105239_10000454
197 Ga0157373_10018501
198 Ga0157371_10017730
199 Ga0171463_1005
200 Ga0183363_1090
201 Ga0209760_100795
202 Ga0209436_102817
203 Ga0209672_101702
204 Ga0207427_106353
205 Ga0209437_100064
206 Ga0209233_1000081
207 Ga0209233_1000131
208 Ga0209455_1003321
209 Ga0209130_1000138
210 Ga0209675_1000596
211 Ga0209025_1001231
212 Ga0209564_1000250
213 Ga0209564_1000369
214 Ga0209256_1000317
215 Ga0207426_1000255
216 Ga0209257_1011682
217 Ga0207696_1007558
218 Ga0207655_1014101
219 Ga0207695_10000788
220 Ga0207671_10000411
221 Ga0207671_10044338
222 Ga0207694_10019258
223 Ga0207640_10009624
224 Ga0207678_10045408
225 Ga0207674_10066657
226 Ga0209371_1000006
227 Ga0268256_1000007
228 Ga0307408_100000563
229 Ga0395899_0158412
230 Ga0395900_0091341
231 Ga0395898_0210904
232 Ga0395905_0332699
233 Ga0237819_00847
234 Ga0439432_017466
235 Ga0450904_000366
236 Ga0466972_0009916
237 Ga0495607_0017794
238 Ga0495632_0012840
239 Ga0495632_0049891
240 Ga0495643_0008500
241 Ga0495663_0003532
242 Ga0495654_0020142
243 Ga0495633_0013205
244 Ga0495661_0021165
245 Ga0496116_0057197
246 Ga0496122_0045811
247 Ga0496123_0052369
248 Ga0501031_0002769
249 Ga0501031_0012439
250 Ga0501031_0114800
251 Ga0501032_0022038
252 Ga0501032_0028115
253 Ga0501032_0044529
254 Ga0501032_0090851
255 Ga0501033_0000446
256 Ga0501033_0003130
257 Ga0501033_0019827
258 Ga0501033_0029784
259 Ga0501033_0067051
260 Ga0501033_0083288
261 Ga0501033_0223763
262 Ga0501034_0004324
263 Ga0501034_0185096
264 Ga0501036_0005424
265 Ga0501036_0029074
266 Ga0501037_0000179
267 Ga0501037_0001481
268 Ga0501037_0077029
269 Ga0501037_0165894
270 Ga0501038_0026285
271 Ga0501038_0102463
272 Ga0501039_0001884
273 Ga0501042_0011846
274 Ga0501043_0000005
275 Ga0501043_0005191
276 Ga0501043_0008314
277 Ga0501046_0021898
278 Ga0501046_0049589
279 Ga0501047_0003716
280 Ga0501047_0043171
281 Ga0501047_0070774
282 Ga0501047_0114296
283 Ga0501047_0121847
284 Ga0501047_0292296
285 Ga0501068_0047823
286 Ga0501069_0000011
287 Ga0501069_0052286
288 Ga0501070_0001424
289 Ga0501070_0013988
290 Ga0501070_0047624
291 Ga0501070_0188915
292 Ga0501070_0292131
293 Ga0501073_0105441
294 Ga0501074_0000336
295 Ga0501080_0001369
296 Ga0501083_0000805
297 Ga0501035_0000107
298 Ga0501035_0007869
299 Ga0501035_0013853
300 Ga0501035_0015836
301 Ga0501035_0039263
302 Ga0501035_0060690
303 Ga0501044_0000154
304 Ga0501044_0005777
305 Ga0501044_0009552
306 Ga0501044_0026084
307 Ga0501044_0026244
308 Ga0501044_0151531
309 Ga0501044_0215300
310 Ga0501044_0279595
311 Ga0501045_0154331
312 Ga0501045_0320788
313 nmdc:mga03683_47509_c1
314 Ga0501082_0015310
315 2535517451
316 2552747272
317 2600196261
318 2617381090
319 2643772220
320 2644106053
321 2644146984
322 2644208385
323 2644310664
324 2644334549
325 2644545252
326 2644616498
327 2644651636
328 2644673344
329 2694634053
330 2694638577
331 2728749168
332 2753461230
333 2778176570
334 2842484267
335 2894025947
336 2917702685
337 2920822677
338 2939631235
339 2996338876
340 8004642784
341 8005546267
342 8057101967

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

17

348

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dwi-assembly1.cif.gz_A molecular mechanism of sialic acid transport mediated by sialin 0.8462 12 369
4zow-assembly1.cif.gz_A crystal structure of e. coli multidrug transporter mdfa in complex with chloramphenicol 0.8144 11 369
6oom-assembly2.cif.gz_A-2 protein a 0.8136 12 369
6vs2-assembly1.cif.gz_A protein d 0.8129 11 370
8ex4-assembly1.cif.gz_A human s1p transporter spns2 in an inward-facing open conformation (state 1) 0.809 14 370
ID Description Score Start End Superfamily
af_P17583_194_375_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.966 196 374 1.20.1250.20
af_P17583_194_375_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9403 196 374 1.20.1250.20
af_P17583_1_184_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9337 13 186 1.20.1250.20
af_P76242_7_383_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9014 11 369 1.20.1250.20
af_Q54YF6_171_383_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8922 13 177 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A3G2T4L4-F1-model_v4 MFS transporter 0.9745 11 381 GO:0016020
GO:0022857
AF-A0A334NA36-F1-model_v4 deleted 0.9701 11 382
AF-A0A009QMF1-F1-model_v4 Major Facilitator Superfamily protein 0.9695 11 382 GO:0016020
GO:0022857
AF-A0A0Q9J9V0-F1-model_v4 MFS transporter 0.9671 13 379 GO:0016020
GO:0022857
AF-U1ZTH3-F1-model_v4 Major facilitator transporter 0.966 12 382 GO:0016020
GO:0022857

Map