F259083

General Info

Members Datasets Scaffolds Average Seq Length
171 131 166 269

Family's Representative Sequence

Representative Sequence 3300032005|Ga0307411_10058365|Ga0307411_100583653
Length 325
Sequence MRPFACAEPTSTLSRDALAGAAAGSSVGAADLVHVRGTSGPGPLATSVRLGMVSVLSKFNIVASGPEDAQPMLFAHGFGCDQHMWRLVAPAFADEYRVILFDYIGAGGSDSSAYDSRRYDSLQGYADDVVEIVRELDLRDVVFVGHSVSSMVGAMAQAAEPERFASLVMVGPSPRYIDDGAYRGGFAEADIVEMLGSLESNYLGWSAAMAPAIMNNPDRPELGEELTTSFCRMDPAIARQFARVTFLSDSRADLCGVTVPTLVLQCTDDLIAPRTVGTYVHDAIPGSDLTLLAATGHCPQLSAPDETIRAITDFLRRHDRAAPRA

Samples

Sample ID Description Type Environment
1 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
2 2842711865 Duganella sp. R-73148 Isolate Unclassified
3 2857553236 Duganella sp. R-74557 Isolate Unclassified
4 2857558681 Duganella sp. R-74565 Isolate Unclassified
5 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
51 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
52 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
77 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
78 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
86 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
87 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
88 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
89 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
90 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
91 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
92 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
93 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
94 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
95 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
96 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
97 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
98 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
99 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
100 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
101 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
102 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
103 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
104 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
105 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
106 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
107 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
108 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
109 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
110 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
111 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
112 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
113 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
114 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
115 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
116 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
117 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
118 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
119 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
120 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
121 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
122 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
123 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
124 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
125 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
126 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
129 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
130 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
131 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.49
Metatranscriptomes 0.58
Isolates 2.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.68
Nodule 0
Rhizoplane 1.17
Rhizosphere 85.96
Stem 0
Stem Tuber 0
Unclassified 8.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10014288 3300005290 Bacteria 1829
2 Ga0070658_10079890 3300005327 Bacteria 2686
3 Ga0070690_100091591 3300005330 Bacteria 2003
4 Ga0070680_100034299 3300005336 Bacteria 4091
5 Ga0070660_100530332 3300005339 Bacteria 981
6 Ga0070689_100013416 3300005340 Bacteria 5929
7 Ga0070687_100031655 3300005343 Bacteria 2596
8 Ga0070661_100043935 3300005344 Bacteria 3264
9 Ga0070668_100503593 3300005347 Bacteria 1049
10 Ga0070675_100119386 3300005354 Bacteria 2239
11 Ga0070674_100042784 3300005356 Bacteria 3079
12 Ga0070673_100184522 3300005364 Bacteria 1787
13 Ga0070659_100043132 3300005366 Bacteria 3528
14 Ga0070667_100055217 3300005367 Bacteria 3354
15 Ga0070662_100100429 3300005457 Bacteria 2189
16 Ga0070681_10028662 3300005458 Bacteria 5598
17 Ga0070681_10088335 3300005458 Bacteria 3052
18 Ga0070681_10116940 3300005458 Bacteria 2603
19 Ga0070679_100018940 3300005530 Bacteria 6684
20 Ga0070679_100024196 3300005530 Bacteria 5951
21 Ga0070679_100040029 3300005530 Bacteria 4661
22 Ga0070697_100234416 3300005536 Bacteria 1566
23 Ga0068853_100082585 3300005539 Bacteria 2814
24 Ga0070686_100069807 3300005544 Bacteria 2296
25 Ga0070695_100003067 3300005545 Bacteria 9719
26 Ga0070696_100019305 3300005546 Bacteria 4615
27 Ga0068859_100034986 3300005617 Bacteria 5039
28 Ga0068861_100218922 3300005719 Bacteria 1608
29 Ga0068858_100115798 3300005842 Bacteria 2505
30 Ga0075365_10012936 3300006038 Bacteria 4974
31 Ga0075365_10065111 3300006038 Bacteria 2442
32 Ga0075364_10002422 3300006051 Bacteria 10448
33 Ga0075370_10067142 3300006353 Bacteria 2047
34 Ga0075429_100220296 3300006880 Bacteria 1662
35 Ga0097620_100034988 3300006931 Bacteria 5039
36 Ga0105240_10498937 3300009093 Bacteria 1354
37 Ga0111539_10053727 3300009094 Bacteria 4795
38 Ga0105248_10149319 3300009177 Bacteria 2637
39 Ga0105237_10638426 3300009545 Bacteria 1072
40 Ga0105238_10058807 3300009551 Bacteria 3852
41 Ga0105249_10057222 3300009553 Bacteria 3571
42 Ga0105239_10018884 3300010375 Bacteria 7617
43 Ga0157369_10133247 3300013105 Bacteria 2632
44 Ga0157369_10157895 3300013105 Bacteria 2395
45 Ga0157374_10141852 3300013296 Unclassified 2333
46 Ga0163162_10172881 3300013306 Bacteria 2285
47 Ga0157372_10171537 3300013307 Bacteria 2510
48 Ga0157375_10128282 3300013308 Bacteria 2654
49 Ga0182008_10016646 3300014497 Bacteria 3819
50 Ga0157377_10121581 3300014745 Bacteria 1583
51 Ga0182006_1000008 3300015261 Bacteria 449652
52 Ga0182007_10015979 3300015262 Bacteria 2781
53 Ga0206354_11108834 3300020081 Bacteria 1106
54 Ga0207697_10043161 3300025315 Bacteria 1854
55 Ga0207688_10114888 3300025901 Bacteria 1566
56 Ga0207688_10214937 3300025901 Bacteria 1156
57 Ga0207705_10524984 3300025909 Bacteria 920
58 Ga0207707_10021329 3300025912 Bacteria 5663
59 Ga0207707_10188346 3300025912 Bacteria 1800
60 Ga0207707_10463592 3300025912 Bacteria 1083
61 Ga0207660_10014625 3300025917 Bacteria 5167
62 Ga0207662_10161473 3300025918 Bacteria 1432
63 Ga0207649_10041592 3300025920 Bacteria 2798
64 Ga0207652_10081004 3300025921 Bacteria 2839
65 Ga0207694_10015919 3300025924 Bacteria 5674
66 Ga0207659_10037500 3300025926 Bacteria 3366
67 Ga0207690_10031611 3300025932 Bacteria 3389
68 Ga0207686_10085370 3300025934 Bacteria 2070
69 Ga0207709_10149187 3300025935 Bacteria 1617
70 Ga0207669_10021831 3300025937 Bacteria 3388
71 Ga0207691_10114082 3300025940 Bacteria 2401
72 Ga0207661_10170237 3300025944 Bacteria 1896
73 Ga0207703_10100325 3300026035 Bacteria 2453
74 Ga0207702_10250449 3300026078 Bacteria 1663
75 Ga0207675_100126333 3300026118 Bacteria 2422
76 Ga0207698_10052465 3300026142 Bacteria 3124
77 Ga0268265_10109529 3300028380 Bacteria 2251
78 Ga0268264_10297263 3300028381 Bacteria 1518
79 Ga0307408_100252761 3300031548 Bacteria 1455
80 Ga0307405_10626138 3300031731 Bacteria 881
81 Ga0307412_10099445 3300031911 Bacteria 2054
82 Ga0307409_100046643 3300031995 Bacteria 3282
83 Ga0307416_100029693 3300032002 Bacteria 4089
84 Ga0307411_10058365 3300032005 Bacteria 2554
85 Ga0307415_100007496 3300032126 Bacteria 5972
86 Ga0307415_100018806 3300032126 Bacteria 4182
87 Ga0307415_100091665 3300032126 Bacteria 2202
88 Ga0395898_0356676 3300037466 Bacteria 1394
89 Ga0395905_0003292 3300037471 Bacteria 17347
90 Ga0395901_0335681 3300038443 Bacteria 1562
91 Ga0451837_0308805 3300041494 Bacteria 969
92 Ga0451853_2234707 3300041512 Bacteria 1376
93 Ga0450896_020186 3300042133 Bacteria 974
94 Ga0450893_0006901 3300042532 Bacteria 1841
95 Ga0466965_0075189 3300044683 Bacteria 1703
96 Ga0466961_0092400 3300044693 Bacteria 1910
97 Ga0466961_0104659 3300044693 Bacteria 1782
98 Ga0466961_0219580 3300044693 Bacteria 1172
99 Ga0466963_0002855 3300044694 Bacteria 9751
100 Ga0466963_0029618 3300044694 Bacteria 3525
101 Ga0466963_0096390 3300044694 Bacteria 2020
102 Ga0466963_0115981 3300044694 Bacteria 1841
103 Ga0466963_0155281 3300044694 Bacteria 1590
104 Ga0466971_0002005 3300044719 Bacteria 8626
105 Ga0466971_0017856 3300044719 Bacteria 3142
106 Ga0466971_0100954 3300044719 Bacteria 1326
107 Ga0466970_0044735 3300044765 Bacteria 2357
108 Ga0466957_0372807 3300044842 Bacteria 972
109 Ga0466960_0007949 3300044901 Bacteria 4331
110 Ga0466959_0024786 3300045049 Bacteria 4443
111 Ga0466959_0304131 3300045049 Bacteria 1092
112 Ga0466958_0000842 3300045836 Bacteria 13605
113 Ga0466958_0018801 3300045836 Bacteria 4014
114 Ga0466958_0035571 3300045836 Bacteria 2976
115 Ga0466958_0042931 3300045836 Bacteria 2722
116 Ga0466958_0092308 3300045836 Bacteria 1874
117 Ga0466967_0009453 3300045976 Bacteria 7233
118 Ga0466967_0029648 3300045976 Bacteria 4582
119 Ga0466967_0035151 3300045976 Bacteria 4261
120 Ga0466967_0057861 3300045976 Bacteria 3424
121 Ga0466967_0099547 3300045976 Bacteria 2655
122 Ga0466967_0149311 3300045976 Bacteria 2183
123 Ga0466967_0190893 3300045976 Bacteria 1936
124 Ga0495627_000001 3300046453 Bacteria 1104709
125 Ga0495638_0155741 3300046460 Bacteria 1322
126 Ga0495650_0003703 3300046471 Bacteria 10947
127 Ga0495584_0027944 3300046491 Bacteria 2858
128 Ga0495585_0112218 3300046492 Bacteria 1448
129 Ga0495596_0002332 3300046500 Bacteria 10295
130 Ga0495606_0005026 3300046507 Bacteria 12882
131 Ga0495610_0045693 3300046512 Bacteria 2165
132 Ga0495643_0000724 3300046522 Bacteria 37749
133 Ga0495644_0007712 3300046523 Bacteria 4150
134 Ga0495654_0011441 3300046530 Bacteria 4801
135 Ga0495609_0000501 3300046538 Bacteria 31420
136 Ga0495597_0060001 3300046542 Bacteria 1660
137 Ga0495625_0009156 3300046660 Bacteria 8325
138 Ga0495669_0000124 3300046684 Bacteria 49700
139 Ga0495669_0031986 3300046684 Bacteria 2311
140 Ga0495649_0116427 3300046694 Bacteria 1415
141 Ga0495660_0000024 3300046810 Bacteria 268209
142 Ga0495660_0000313 3300046810 Bacteria 43991
143 Ga0495672_0088020 3300047320 Bacteria 1713
144 Ga0495626_0000225 3300048091 Bacteria 66619
145 Ga0495626_0010968 3300048091 Bacteria 4811
146 Ga0495626_0024920 3300048091 Bacteria 2929
147 Ga0496106_0361943 3300048909 Bacteria 1165
148 Ga0496110_0455749 3300048913 Bacteria 1165
149 Ga0496116_0053077 3300048919 Bacteria 2680
150 Ga0496122_0000127 3300048925 Bacteria 178260
151 Ga0496123_0000084 3300048926 Bacteria 187479
152 Ga0496124_0006348 3300048927 Bacteria 12907
153 Ga0496124_0007374 3300048927 Bacteria 11702
154 Ga0496125_0005968 3300048928 Bacteria 13334
155 Ga0496125_0196434 3300048928 Bacteria 1326
156 Ga0496126_0000027 3300048929 Bacteria 396518
157 Ga0495678_000002 3300049459 Bacteria 999613
158 Ga0501080_0045322 3300049742 Bacteria 4094
159 nmdc:mga0yw44_119018_c1 3300050492 Bacteria 1700
160 nmdc:mga0yw44_1526_c1 3300050492 Bacteria 9254
161 nmdc:mga0yw44_225136_c1 3300050492 Bacteria 1244
162 nmdc:mga0yw44_79679_c1 3300050492 Bacteria 2050
163 nmdc:mga08y16_78416_c1 3300050511 Bacteria 3444
164 Ga0590075_026140 3300059424 Bacteria 1469
165 Ga0466962_0005857 3300061719 Bacteria 5904
166 Ga0466962_0021314 3300061719 Bacteria 3113

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046522 Ga0495643_0000724 Ga0495643_0000724_26807_27520 237
2 3300047320 Ga0495672_0088020 Ga0495672_0088020_966_1679 237
3 3300048091 Ga0495626_0010968 Ga0495626_0010968_2833_3546 237
4 3300048925 Ga0496122_0000127 Ga0496122_0000127_158546_159295 249
5 3300048926 Ga0496123_0000084 Ga0496123_0000084_18460_19209 249
6 3300048928 Ga0496125_0005968 Ga0496125_0005968_5506_6255 249
7 3300049459 Ga0495678_000002 Ga0495678_000002_279424_280227 249
8 3300005336 Ga0070680_100034299 Ga0070680_1000342996 258
9 3300020081 Ga0206354_11108834 Ga0206354_111088342 258
10 3300005327 Ga0070658_10079890 Ga0070658_100798903 261
11 3300005458 Ga0070681_10028662 Ga0070681_100286623 261
12 3300005458 Ga0070681_10116940 Ga0070681_101169402 261
13 3300005530 Ga0070679_100024196 Ga0070679_1000241962 261
14 3300005530 Ga0070679_100040029 Ga0070679_1000400294 261
15 3300013307 Ga0157372_10171537 Ga0157372_101715373 261
16 3300014497 Ga0182008_10016646 Ga0182008_100166464 261
17 3300015262 Ga0182007_10015979 Ga0182007_100159793 261
18 3300025912 Ga0207707_10021329 Ga0207707_100213294 261
19 3300025912 Ga0207707_10463592 Ga0207707_104635922 261
20 3300025917 Ga0207660_10014625 Ga0207660_100146254 261
21 3300025921 Ga0207652_10081004 Ga0207652_100810043 261
22 3300026078 Ga0207702_10250449 Ga0207702_102504492 261
23 3300041494 Ga0451837_0308805 Ga0451837_0308805_160_951 261
24 3300044693 Ga0466961_0219580 Ga0466961_0219580_125_916 261
25 3300044694 Ga0466963_0096390 Ga0466963_0096390_360_1151 261
26 3300044694 Ga0466963_0115981 Ga0466963_0115981_781_1572 261
27 3300044694 Ga0466963_0155281 Ga0466963_0155281_610_1401 261
28 3300044719 Ga0466971_0100954 Ga0466971_0100954_176_967 261
29 3300044842 Ga0466957_0372807 Ga0466957_0372807_46_837 261
30 3300045836 Ga0466958_0000842 Ga0466958_0000842_12201_12992 261
31 3300045836 Ga0466958_0042931 Ga0466958_0042931_870_1661 261
32 3300045836 Ga0466958_0092308 Ga0466958_0092308_309_1100 261
33 3300045976 Ga0466967_0009453 Ga0466967_0009453_2092_2883 261
34 3300045976 Ga0466967_0029648 Ga0466967_0029648_2173_2964 261
35 3300045976 Ga0466967_0035151 Ga0466967_0035151_848_1639 261
36 3300045976 Ga0466967_0057861 Ga0466967_0057861_65_856 261
37 3300045976 Ga0466967_0149311 Ga0466967_0149311_829_1620 261
38 3300045976 Ga0466967_0190893 Ga0466967_0190893_249_1040 261
39 3300059424 Ga0590075_026140 Ga0590075_026140_413_1204 261
40 3300032126 Ga0307415_100091665 Ga0307415_1000916652 262
41 3300061719 Ga0466962_0021314 Ga0466962_0021314_1624_2415 262
42 iso_pu_bacteria 2857553236 2857555281 262
43 iso_pu_bacteria 2919527303 2919533241 262
44 iso_pu_bacteria 2808606418 2809142814 263
45 iso_pu_bacteria 2842711865 2842713518 263
46 iso_pu_bacteria 2857558681 2857561382 263
47 3300005339 Ga0070660_100530332 Ga0070660_1005303321 264
48 3300009545 Ga0105237_10638426 Ga0105237_106384262 264
49 3300010375 Ga0105239_10018884 Ga0105239_100188844 264
50 3300025909 Ga0207705_10524984 Ga0207705_105249841 264
51 3300044901 Ga0466960_0007949 Ga0466960_0007949_2854_3657 264
52 3300048909 Ga0496106_0361943 Ga0496106_0361943_73_873 264
53 3300048913 Ga0496110_0455749 Ga0496110_0455749_129_929 264
54 3300041512 Ga0451853_2234707 Ga0451853_2234707_559_1362 265
55 3300046471 Ga0495650_0003703 Ga0495650_0003703_7593_8393 265
56 3300006880 Ga0075429_100220296 Ga0075429_1002202963 266
57 3300009094 Ga0111539_10053727 Ga0111539_100537274 266
58 3300015261 Ga0182006_1000008 Ga0182006_100000874 266
59 3300025901 Ga0207688_10114888 Ga0207688_101148882 266
60 3300025944 Ga0207661_10170237 Ga0207661_101702373 266
61 3300037471 Ga0395905_0003292 Ga0395905_0003292_2094_2897 266
62 3300038443 Ga0395901_0335681 Ga0395901_0335681_710_1513 266
63 3300042133 Ga0450896_020186 Ga0450896_020186_70_873 266
64 3300042532 Ga0450893_0006901 Ga0450893_0006901_724_1527 266
65 3300046453 Ga0495627_000001 Ga0495627_000001_278197_279000 266
66 3300046491 Ga0495584_0027944 Ga0495584_0027944_1617_2420 266
67 3300046492 Ga0495585_0112218 Ga0495585_0112218_303_1106 266
68 3300046500 Ga0495596_0002332 Ga0495596_0002332_455_1258 266
69 3300046523 Ga0495644_0007712 Ga0495644_0007712_2493_3296 266
70 3300046530 Ga0495654_0011441 Ga0495654_0011441_755_1561 266
71 3300046538 Ga0495609_0000501 Ga0495609_0000501_4458_5261 266
72 3300046542 Ga0495597_0060001 Ga0495597_0060001_228_1031 266
73 3300046684 Ga0495669_0000124 Ga0495669_0000124_15174_15977 266
74 3300046810 Ga0495660_0000313 Ga0495660_0000313_38899_39702 266
75 3300048091 Ga0495626_0024920 Ga0495626_0024920_244_1047 266
76 3300048919 Ga0496116_0053077 Ga0496116_0053077_1322_2125 266
77 3300048927 Ga0496124_0006348 Ga0496124_0006348_10385_11188 266
78 3300048927 Ga0496124_0007374 Ga0496124_0007374_6028_6831 266
79 3300050492 nmdc:mga0yw44_119018_c1 nmdc:mga0yw44_119018_c1_568_1383 266
80 3300050511 nmdc:mga08y16_78416_c1 nmdc:mga08y16_78416_c1_2199_3014 266
81 3300005344 Ga0070661_100043935 Ga0070661_1000439354 267
82 3300005356 Ga0070674_100042784 Ga0070674_1000427842 267
83 3300005366 Ga0070659_100043132 Ga0070659_1000431323 267
84 3300005539 Ga0068853_100082585 Ga0068853_1000825851 267
85 3300006038 Ga0075365_10012936 Ga0075365_100129362 267
86 3300006038 Ga0075365_10065111 Ga0075365_100651112 267
87 3300006051 Ga0075364_10002422 Ga0075364_1000242210 267
88 3300006353 Ga0075370_10067142 Ga0075370_100671422 267
89 3300009093 Ga0105240_10498937 Ga0105240_104989372 267
90 3300009551 Ga0105238_10058807 Ga0105238_100588075 267
91 3300013105 Ga0157369_10133247 Ga0157369_101332471 267
92 3300013105 Ga0157369_10157895 Ga0157369_101578951 267
93 3300013296 Ga0157374_10141852 Ga0157374_101418523 267
94 3300025901 Ga0207688_10214937 Ga0207688_102149371 267
95 3300025920 Ga0207649_10041592 Ga0207649_100415922 267
96 3300025924 Ga0207694_10015919 Ga0207694_100159196 267
97 3300025932 Ga0207690_10031611 Ga0207690_100316113 267
98 3300025937 Ga0207669_10021831 Ga0207669_100218312 267
99 3300026142 Ga0207698_10052465 Ga0207698_100524652 267
100 3300031731 Ga0307405_10626138 Ga0307405_106261381 267
101 3300031911 Ga0307412_10099445 Ga0307412_100994452 267
102 3300031995 Ga0307409_100046643 Ga0307409_1000466433 267
103 3300032002 Ga0307416_100029693 Ga0307416_1000296932 267
104 3300032126 Ga0307415_100007496 Ga0307415_1000074963 267
105 3300044683 Ga0466965_0075189 Ga0466965_0075189_255_1067 267
106 3300044693 Ga0466961_0092400 Ga0466961_0092400_507_1319 267
107 3300044693 Ga0466961_0104659 Ga0466961_0104659_638_1453 267
108 3300044694 Ga0466963_0029618 Ga0466963_0029618_2440_3252 267
109 3300044719 Ga0466971_0002005 Ga0466971_0002005_6930_7742 267
110 3300044765 Ga0466970_0044735 Ga0466970_0044735_214_1026 267
111 3300045049 Ga0466959_0304131 Ga0466959_0304131_186_1001 267
112 3300045836 Ga0466958_0018801 Ga0466958_0018801_748_1560 267
113 3300045976 Ga0466967_0099547 Ga0466967_0099547_520_1332 267
114 3300046460 Ga0495638_0155741 Ga0495638_0155741_494_1303 267
115 3300046507 Ga0495606_0005026 Ga0495606_0005026_7951_8790 267
116 3300046512 Ga0495610_0045693 Ga0495610_0045693_249_1061 267
117 3300046660 Ga0495625_0009156 Ga0495625_0009156_3200_4012 267
118 3300046694 Ga0495649_0116427 Ga0495649_0116427_416_1228 267
119 3300046810 Ga0495660_0000024 Ga0495660_0000024_71675_72481 267
120 3300048928 Ga0496125_0196434 Ga0496125_0196434_282_1097 267
121 3300048929 Ga0496126_0000027 Ga0496126_0000027_135514_136329 267
122 3300049742 Ga0501080_0045322 Ga0501080_0045322_2974_3789 267
123 3300050492 nmdc:mga0yw44_1526_c1 nmdc:mga0yw44_1526_c1_2298_3113 267
124 3300050492 nmdc:mga0yw44_225136_c1 nmdc:mga0yw44_225136_c1_106_921 267
125 3300050492 nmdc:mga0yw44_79679_c1 nmdc:mga0yw44_79679_c1_819_1634 267
126 3300061719 Ga0466962_0005857 Ga0466962_0005857_2933_3745 267
127 3300005458 Ga0070681_10088335 Ga0070681_100883353 268
128 3300005536 Ga0070697_100234416 Ga0070697_1002344162 268
129 3300005545 Ga0070695_100003067 Ga0070695_1000030673 268
130 3300005546 Ga0070696_100019305 Ga0070696_1000193052 268
131 3300025912 Ga0207707_10188346 Ga0207707_101883461 268
132 3300031548 Ga0307408_100252761 Ga0307408_1002527612 268
133 3300005340 Ga0070689_100013416 Ga0070689_1000134164 269
134 3300005347 Ga0070668_100503593 Ga0070668_1005035931 269
135 3300026035 Ga0207703_10100325 Ga0207703_101003253 269
136 3300046684 Ga0495669_0031986 Ga0495669_0031986_316_1128 269
137 3300005530 Ga0070679_100018940 Ga0070679_1000189404 270
138 3300032005 Ga0307411_10058365 Ga0307411_100583653 270
139 3300032126 Ga0307415_100018806 Ga0307415_1000188062 270
140 3300037466 Ga0395898_0356676 Ga0395898_0356676_501_1376 270
141 3300048091 Ga0495626_0000225 Ga0495626_0000225_31068_31994 272
142 3300005290 Ga0065712_10014288 Ga0065712_100142882 273
143 3300005330 Ga0070690_100091591 Ga0070690_1000915912 273
144 3300005343 Ga0070687_100031655 Ga0070687_1000316552 273
145 3300005354 Ga0070675_100119386 Ga0070675_1001193862 273
146 3300005364 Ga0070673_100184522 Ga0070673_1001845222 273
147 3300005367 Ga0070667_100055217 Ga0070667_1000552172 273
148 3300005457 Ga0070662_100100429 Ga0070662_1001004292 273
149 3300005544 Ga0070686_100069807 Ga0070686_1000698071 273
150 3300005617 Ga0068859_100034986 Ga0068859_1000349862 273
151 3300005719 Ga0068861_100218922 Ga0068861_1002189222 273
152 3300005842 Ga0068858_100115798 Ga0068858_1001157982 273
153 3300006931 Ga0097620_100034988 Ga0097620_1000349882 273
154 3300009177 Ga0105248_10149319 Ga0105248_101493192 273
155 3300009553 Ga0105249_10057222 Ga0105249_100572222 273
156 3300013306 Ga0163162_10172881 Ga0163162_101728812 273
157 3300013308 Ga0157375_10128282 Ga0157375_101282822 273
158 3300014745 Ga0157377_10121581 Ga0157377_101215812 273
159 3300025315 Ga0207697_10043161 Ga0207697_100431612 273
160 3300025918 Ga0207662_10161473 Ga0207662_101614732 273
161 3300025926 Ga0207659_10037500 Ga0207659_100375002 273
162 3300025934 Ga0207686_10085370 Ga0207686_100853702 273
163 3300025935 Ga0207709_10149187 Ga0207709_101491872 273
164 3300025940 Ga0207691_10114082 Ga0207691_101140822 273
165 3300026118 Ga0207675_100126333 Ga0207675_1001263332 273
166 3300028380 Ga0268265_10109529 Ga0268265_101095292 273
167 3300028381 Ga0268264_10297263 Ga0268264_102972632 273
168 3300044694 Ga0466963_0002855 Ga0466963_0002855_6117_6992 273
169 3300044719 Ga0466971_0017856 Ga0466971_0017856_293_1168 273
170 3300045049 Ga0466959_0024786 Ga0466959_0024786_667_1542 273
171 3300045836 Ga0466958_0035571 Ga0466958_0035571_1719_2594 273

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

70

304

0.87

PF12146

Hydrolase_4

Serine aminopeptidase, S33

67

298

0.74

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

72

310

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wom-assembly2.cif.gz_B crystal structure of rsbq 0.9841 8 270
3qvm-assembly1.cif.gz_A the structure of olei00960, a hydrolase from oleispira antarctica 0.9799 9 268
7tvw-assembly1.cif.gz_A crystal structure of arabidopsis thaliana dlk2 0.9781 9 268
7ukb-assembly1.cif.gz_A ancestral reconstruction of a plant alpha/beta-hydrolase 0.9746 9 268
6azb-assembly2.cif.gz_B crystal structure of physcomitrella patens kai2-like e 0.9742 10 265
ID Description Score Start End Superfamily
af_I1JQE4_7_273_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.978 6 267 3.40.50.1820
af_Q9LK01_7_272_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.975 9 267 3.40.50.1820
af_B6TRW7_40_307_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9749 9 265 3.40.50.1820
1wprB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9709 8 269 3.40.50.1820
af_K7MZE6_14_233_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9677 88 267 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2D7VRH4-F1-model_v4 Alpha/beta hydrolase 0.9963 82 267 GO:0016787
AF-A0A4R8FMV3-F1-model_v4 PAS domain S-box-containing protein 0.9956 8 266
AF-A0A076HU39-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9956 40 267
AF-A0A1U6H673-F1-model_v4 Sigma-B regulation protein RsbQ 0.9955 24 267
AF-A0A2U8HWC4-F1-model_v4 deleted 0.9951 8 266

Feature Viewer

pLDDT pTM Quality
93.93 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map