F258943

General Info

Members Datasets Scaffolds Average Seq Length
171 128 170 271

Family's Representative Sequence

Representative Sequence 3300025981|Ga0207640_10164457|Ga0207640_101644572
Length 309
Sequence MIGNSLLDSHVKRPYLVSQSTNLPWRCDVGTKSAIETPSSRVPRRNTVDVHRFGPWAVVTGASSGIGLEFARQLARAGLNIVLVSRRPQVLAEIGAELTRDFGVEHRVVAADLSTEEGPQRIADATADLDVGLLVSNAGTGQPGNFLAFSETDLRQIAQLNAISYMVLTHHFGRRLVTRGRGGVLLVSAMGADEGIPYSAKEAATKALVSTLGRGLHVEFERLGLGLTVLVVSPTDTPIIDKMGFTRNAMPVKPMPVERCVQEALAALGANRASIMPGRLYRIMNRLMPASLSRRMTATMMLKSSTFVA

Samples

Sample ID Description Type Environment
1 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
52 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
78 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
79 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
80 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
85 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
86 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
87 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
88 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
89 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
90 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
91 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
92 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
93 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
94 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
95 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
96 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
97 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
98 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
99 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
100 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
101 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
102 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
103 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
104 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
105 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
106 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
107 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
108 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
109 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
110 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
111 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
112 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
113 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
114 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
115 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
116 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
117 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
118 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
119 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
120 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
121 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
122 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
123 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
124 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
125 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
126 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
127 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
128 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0
Isolates 0.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.75
Nodule 0
Rhizoplane 1.75
Rhizosphere 89.47
Stem 0
Stem Tuber 0
Unclassified 7.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10029275 3300003320 Bacteria 6144
2 rootH1_10206791 3300003323 Unclassified 2254
3 rootH1_10221674 3300003323 Bacteria 2543
4 rootH1_10236940 3300003323 Bacteria 1049
5 Ga0065704_10115270 3300005289 Bacteria 1875
6 Ga0070658_10006408 3300005327 Bacteria 9538
7 Ga0070658_10019895 3300005327 Bacteria 5377
8 Ga0070683_100017760 3300005329 Bacteria 6285
9 Ga0070683_100050554 3300005329 Bacteria 3848
10 Ga0070683_100113825 3300005329 Bacteria 2553
11 Ga0070690_100104063 3300005330 Bacteria 1885
12 Ga0068868_100305911 3300005338 Unclassified 1351
13 Ga0070660_100060937 3300005339 Bacteria 2929
14 Ga0070661_100021664 3300005344 Bacteria 4594
15 Ga0070688_100235080 3300005365 Unclassified 1298
16 Ga0070659_100238305 3300005366 Bacteria 1505
17 Ga0070659_100292948 3300005366 Bacteria 1356
18 Ga0070709_10079079 3300005434 Unclassified 2141
19 Ga0070714_100088009 3300005435 Bacteria 2717
20 Ga0070714_100209798 3300005435 Unclassified 1785
21 Ga0070713_100120761 3300005436 Bacteria 2298
22 Ga0070713_100415179 3300005436 Archaea 1259
23 Ga0070711_100320528 3300005439 Unclassified 1238
24 Ga0070681_10024739 3300005458 Bacteria 6040
25 Ga0070685_10117739 3300005466 Unclassified 1646
26 Ga0070706_100004891 3300005467 Unclassified 12823
27 Ga0070706_100044937 3300005467 Bacteria 4079
28 Ga0070706_100266118 3300005467 Bacteria 1600
29 Ga0070707_100134674 3300005468 Unclassified 2403
30 Ga0070679_100030428 3300005530 Bacteria 5330
31 Ga0070684_100014611 3300005535 Bacteria 6366
32 Ga0070684_100217322 3300005535 Unclassified 1743
33 Ga0070684_100469014 3300005535 Bacteria 1164
34 Ga0068853_100028322 3300005539 Bacteria 4711
35 Ga0070686_100218402 3300005544 Unclassified 1376
36 Ga0068855_100119657 3300005563 Bacteria 3015
37 Ga0070664_100232698 3300005564 Bacteria 1652
38 Ga0068857_100122962 3300005577 Bacteria 2338
39 Ga0068854_100281530 3300005578 Bacteria 1339
40 Ga0068856_100009832 3300005614 Bacteria 9290
41 Ga0068856_100103503 3300005614 Bacteria 2840
42 Ga0068852_100060764 3300005616 Bacteria 3281
43 Ga0068852_100389682 3300005616 Bacteria 1368
44 Ga0081539_10000246 3300005985 Bacteria 127353
45 Ga0081539_10005665 3300005985 Bacteria 12545
46 Ga0081539_10029030 3300005985 Bacteria 3467
47 Ga0081539_10139139 3300005985 Unclassified 1182
48 Ga0070717_10041051 3300006028 Unclassified 3771
49 Ga0070717_10060752 3300006028 Bacteria 3130
50 Ga0070717_10174634 3300006028 Bacteria 1870
51 Ga0075363_100193906 3300006048 Bacteria 1159
52 Ga0070716_100017517 3300006173 Bacteria 3715
53 Ga0070712_100225208 3300006175 Bacteria 1486
54 Ga0099795_10007949 3300007788 Bacteria 2993
55 Ga0105240_10285707 3300009093 Bacteria 1893
56 Ga0105240_10395449 3300009093 Bacteria 1558
57 Ga0105245_10029089 3300009098 Bacteria 4880
58 Ga0114129_10446462 3300009147 Bacteria 1697
59 Ga0105243_10733166 3300009148 Unclassified 967
60 Ga0105237_10068194 3300009545 Bacteria 3551
61 Ga0105237_10106493 3300009545 Bacteria 2796
62 Ga0105238_10200084 3300009551 Bacteria 1973
63 Ga0105239_10097955 3300010375 Bacteria 3241
64 Ga0105239_10170003 3300010375 Bacteria 2437
65 Ga0157373_10094051 3300013100 Bacteria 2110
66 Ga0157373_10248546 3300013100 Unclassified 1258
67 Ga0157370_10136641 3300013104 Bacteria 2284
68 Ga0157370_10214551 3300013104 Bacteria 1783
69 Ga0157369_10027342 3300013105 Bacteria 6324
70 Ga0157369_10091055 3300013105 Bacteria 3256
71 Ga0157378_10031142 3300013297 Bacteria 4711
72 Ga0163162_10382455 3300013306 Bacteria 1541
73 Ga0157372_10035966 3300013307 Bacteria 5454
74 Ga0157372_10062006 3300013307 Bacteria 4188
75 Ga0157379_10264172 3300014968 Bacteria 1564
76 Ga0213876_10041653 3300021384 Bacteria 2426
77 Ga0207647_10093457 3300025904 Bacteria 1792
78 Ga0207705_10009953 3300025909 Bacteria 6923
79 Ga0207705_10096388 3300025909 Bacteria 2171
80 Ga0207684_10012072 3300025910 Bacteria 7521
81 Ga0207684_10035273 3300025910 Bacteria 4248
82 Ga0207684_10253076 3300025910 Bacteria 1520
83 Ga0207707_10035813 3300025912 Bacteria 4340
84 Ga0207695_10021284 3300025913 Bacteria 7405
85 Ga0207695_10057317 3300025913 Bacteria 4048
86 Ga0207695_10075097 3300025913 Plasmid 3440
87 Ga0207671_10002226 3300025914 Bacteria 21038
88 Ga0207693_10205824 3300025915 Bacteria 1547
89 Ga0207693_10269329 3300025915 Bacteria 1335
90 Ga0207663_10314260 3300025916 Unclassified 1175
91 Ga0207660_10181656 3300025917 Bacteria 1634
92 Ga0207657_10031700 3300025919 Bacteria 4783
93 Ga0207657_10104991 3300025919 Bacteria 2340
94 Ga0207649_10027702 3300025920 Bacteria 3329
95 Ga0207649_10064737 3300025920 Bacteria 2312
96 Ga0207646_10253701 3300025922 Unclassified 1589
97 Ga0207694_10095006 3300025924 Bacteria 2356
98 Ga0207687_10006827 3300025927 Bacteria 7517
99 Ga0207664_10011737 3300025929 Bacteria 6244
100 Ga0207664_10070168 3300025929 Bacteria 2819
101 Ga0207664_10113389 3300025929 Bacteria 2257
102 Ga0207664_10591886 3300025929 Bacteria 996
103 Ga0207690_10156279 3300025932 Bacteria 1695
104 Ga0207669_10051476 3300025937 Bacteria 2468
105 Ga0207665_10026219 3300025939 Bacteria 3847
106 Ga0207661_10062777 3300025944 Bacteria 3007
107 Ga0207661_10067611 3300025944 Bacteria 2906
108 Ga0207679_10021121 3300025945 Bacteria 4406
109 Ga0207667_10002347 3300025949 Bacteria 23722
110 Ga0207667_10080721 3300025949 Bacteria 3370
111 Ga0207640_10017176 3300025981 Bacteria 4227
112 Ga0207640_10164457 3300025981 Bacteria 1646
113 Ga0207702_10036423 3300026078 Bacteria 4116
114 Ga0207702_10123627 3300026078 Bacteria 2319
115 Ga0207674_10165695 3300026116 Bacteria 2164
116 Ga0207674_10197141 3300026116 Bacteria 1963
117 Ga0207698_10092328 3300026142 Bacteria 2481
118 Ga0307516_10007492 3300031730 Bacteria 12552
119 Ga0307507_10040730 3300033179 Bacteria 4661
120 Ga0373954_0035034 3300035118 Bacteria 2327
121 Ga0373937_0015836 3300036401 Bacteria 6682
122 Ga0373925_0459761 3300037068 Bacteria 1043
123 Ga0395900_0114863 3300037418 Bacteria 2763
124 Ga0436365_0701287 3300039437 Bacteria 22601
125 Ga0436363_0094958 3300039450 Plasmid 3890
126 Ga0466972_0081666 3300044658 Bacteria 1539
127 Ga0466966_0002214 3300044684 Bacteria 12646
128 Ga0466971_0092814 3300044719 Bacteria 1383
129 Ga0466968_0004464 3300044735 Bacteria 5234
130 Ga0466968_0027717 3300044735 Bacteria 2332
131 Ga0466970_0045001 3300044765 Bacteria 2350
132 Ga0466958_0021198 3300045836 Bacteria 3795
133 Ga0495651_0084440 3300046462 Bacteria 2392
134 Ga0495653_0051001 3300046463 Bacteria 3179
135 Ga0495582_0003357 3300046473 Bacteria 9004
136 Ga0495639_0004212 3300046475 Bacteria 6169
137 Ga0495664_0140786 3300046477 Bacteria 1462
138 Ga0495594_0005126 3300046499 Bacteria 6741
139 Ga0495618_0038561 3300046514 Bacteria 3004
140 Ga0495628_0076885 3300046516 Bacteria 2597
141 Ga0495666_0005242 3300046526 Bacteria 6540
142 Ga0495652_0006574 3300046529 Bacteria 10800
143 Ga0495665_0012674 3300046531 Bacteria 4563
144 Ga0495586_0027146 3300046535 Bacteria 3064
145 Ga0495587_0023547 3300046536 Bacteria 3784
146 Ga0495667_0021532 3300046559 Bacteria 4350
147 Ga0495634_0005580 3300046642 Bacteria 9654
148 Ga0495635_0007277 3300046663 Bacteria 7733
149 Ga0495588_0037772 3300046674 Bacteria 2455
150 Ga0495599_0025202 3300046678 Bacteria 3722
151 Ga0495623_0070760 3300046679 Bacteria 2172
152 Ga0495613_0037940 3300046689 Bacteria 3571
153 Ga0495600_0030654 3300046809 Bacteria 3483
154 Ga0495604_0018382 3300047317 Bacteria 5597
155 Ga0495674_0168170 3300047319 Unclassified 1831
156 Ga0495676_0054254 3300047321 Bacteria 3187
157 Ga0495680_0026797 3300047322 Bacteria 4746
158 Ga0495675_0024878 3300047444 Bacteria 3819
159 Ga0495593_0072415 3300047673 Bacteria 1789
160 Ga0496102_0083883 3300048905 Bacteria 2940
161 Ga0496112_0251797 3300048915 Bacteria 1717
162 Ga0496115_0142981 3300048918 Unclassified 1973
163 Ga0496117_0024739 3300048920 Bacteria 4737
164 Ga0496118_0000604 3300048921 Bacteria 59356
165 nmdc:mga03n38_95594_c1 3300050490 Bacteria 1423
166 nmdc:mga05p37_637033_c1 3300050507 Bacteria 1196
167 nmdc:mga08y16_187108_c1 3300050511 Bacteria 2148
168 Ga0500583_0000017 3300053092 Bacteria 141647
169 Ga0590075_003128 3300059424 Bacteria 3932
170 Ga0466962_0089703 3300061719 Bacteria 1472

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037068 Ga0373925_0459761 Ga0373925_0459761_356_1030 224
2 3300006028 Ga0070717_10041051 Ga0070717_100410514 232
3 3300013100 Ga0157373_10094051 Ga0157373_100940513 235
4 3300025904 Ga0207647_10093457 Ga0207647_100934571 235
5 3300025919 Ga0207657_10031700 Ga0207657_100317005 235
6 3300025937 Ga0207669_10051476 Ga0207669_100514763 235
7 3300005435 Ga0070714_100088009 Ga0070714_1000880092 253
8 3300021384 Ga0213876_10041653 Ga0213876_100416532 253
9 3300025910 Ga0207684_10012072 Ga0207684_100120724 253
10 3300025929 Ga0207664_10113389 Ga0207664_101133893 253
11 3300039437 Ga0436365_0701287 Ga0436365_0701287_9327_10130 253
12 3300061719 Ga0466962_0089703 Ga0466962_0089703_687_1448 253
13 3300025929 Ga0207664_10011737 Ga0207664_100117376 255
14 3300048915 Ga0496112_0251797 Ga0496112_0251797_402_1220 259
15 iso_pu_bacteria 2867507094 2867508455 260
16 3300003323 rootH1_10236940 rootH1_102369401 263
17 3300005338 Ga0068868_100305911 Ga0068868_1003059111 263
18 3300005365 Ga0070688_100235080 Ga0070688_1002350801 263
19 3300005466 Ga0070685_10117739 Ga0070685_101177392 263
20 3300005544 Ga0070686_100218402 Ga0070686_1002184022 263
21 3300014968 Ga0157379_10264172 Ga0157379_102641721 263
22 3300013306 Ga0163162_10382455 Ga0163162_103824551 264
23 3300005564 Ga0070664_100232698 Ga0070664_1002326982 265
24 3300009148 Ga0105243_10733166 Ga0105243_107331661 265
25 3300009545 Ga0105237_10068194 Ga0105237_100681943 265
26 3300025914 Ga0207671_10002226 Ga0207671_1000222620 265
27 3300025915 Ga0207693_10205824 Ga0207693_102058242 265
28 3300025945 Ga0207679_10021121 Ga0207679_100211213 265
29 3300025981 Ga0207640_10017176 Ga0207640_100171763 265
30 3300026116 Ga0207674_10197141 Ga0207674_101971412 265
31 3300037418 Ga0395900_0114863 Ga0395900_0114863_890_1687 265
32 3300044658 Ga0466972_0081666 Ga0466972_0081666_151_948 265
33 3300044735 Ga0466968_0027717 Ga0466968_0027717_932_1729 265
34 3300046462 Ga0495651_0084440 Ga0495651_0084440_685_1491 265
35 3300046463 Ga0495653_0051001 Ga0495653_0051001_1283_2089 265
36 3300046473 Ga0495582_0003357 Ga0495582_0003357_2360_3166 265
37 3300046475 Ga0495639_0004212 Ga0495639_0004212_522_1328 265
38 3300046477 Ga0495664_0140786 Ga0495664_0140786_564_1370 265
39 3300046499 Ga0495594_0005126 Ga0495594_0005126_3295_4101 265
40 3300046514 Ga0495618_0038561 Ga0495618_0038561_204_1010 265
41 3300046516 Ga0495628_0076885 Ga0495628_0076885_1769_2575 265
42 3300046526 Ga0495666_0005242 Ga0495666_0005242_4852_5658 265
43 3300046529 Ga0495652_0006574 Ga0495652_0006574_972_1778 265
44 3300046531 Ga0495665_0012674 Ga0495665_0012674_2585_3391 265
45 3300046535 Ga0495586_0027146 Ga0495586_0027146_526_1332 265
46 3300046536 Ga0495587_0023547 Ga0495587_0023547_274_1080 265
47 3300046559 Ga0495667_0021532 Ga0495667_0021532_1044_1850 265
48 3300046642 Ga0495634_0005580 Ga0495634_0005580_364_1170 265
49 3300046663 Ga0495635_0007277 Ga0495635_0007277_754_1560 265
50 3300046674 Ga0495588_0037772 Ga0495588_0037772_520_1326 265
51 3300046678 Ga0495599_0025202 Ga0495599_0025202_2824_3630 265
52 3300046679 Ga0495623_0070760 Ga0495623_0070760_568_1374 265
53 3300046689 Ga0495613_0037940 Ga0495613_0037940_93_899 265
54 3300046809 Ga0495600_0030654 Ga0495600_0030654_2100_2906 265
55 3300047317 Ga0495604_0018382 Ga0495604_0018382_210_1016 265
56 3300047321 Ga0495676_0054254 Ga0495676_0054254_2371_3177 265
57 3300047322 Ga0495680_0026797 Ga0495680_0026797_1210_2016 265
58 3300047444 Ga0495675_0024878 Ga0495675_0024878_2355_3161 265
59 3300047673 Ga0495593_0072415 Ga0495593_0072415_907_1713 265
60 3300048905 Ga0496102_0083883 Ga0496102_0083883_2033_2830 265
61 3300048920 Ga0496117_0024739 Ga0496117_0024739_3805_4602 265
62 3300048921 Ga0496118_0000604 Ga0496118_0000604_46014_46811 265
63 3300050511 nmdc:mga08y16_187108_c1 nmdc:mga08y16_187108_c1_971_1792 265
64 3300053092 Ga0500583_0000017 Ga0500583_0000017_46011_46808 265
65 3300005435 Ga0070714_100209798 Ga0070714_1002097982 266
66 3300005436 Ga0070713_100120761 Ga0070713_1001207613 266
67 3300005436 Ga0070713_100415179 Ga0070713_1004151791 266
68 3300005614 Ga0068856_100009832 Ga0068856_10000983212 266
69 3300006048 Ga0075363_100193906 Ga0075363_1001939061 266
70 3300009093 Ga0105240_10395449 Ga0105240_103954492 266
71 3300025929 Ga0207664_10070168 Ga0207664_100701681 266
72 3300025929 Ga0207664_10591886 Ga0207664_105918861 266
73 3300026078 Ga0207702_10036423 Ga0207702_100364234 266
74 3300044684 Ga0466966_0002214 Ga0466966_0002214_4824_5624 266
75 3300044719 Ga0466971_0092814 Ga0466971_0092814_551_1351 266
76 3300044735 Ga0466968_0004464 Ga0466968_0004464_4387_5187 266
77 3300044765 Ga0466970_0045001 Ga0466970_0045001_63_863 266
78 3300045836 Ga0466958_0021198 Ga0466958_0021198_674_1474 266
79 3300050490 nmdc:mga03n38_95594_c1 nmdc:mga03n38_95594_c1_126_926 266
80 3300059424 Ga0590075_003128 Ga0590075_003128_2333_3133 266
81 3300005434 Ga0070709_10079079 Ga0070709_100790792 267
82 3300005467 Ga0070706_100266118 Ga0070706_1002661183 267
83 3300006173 Ga0070716_100017517 Ga0070716_1000175172 267
84 3300006175 Ga0070712_100225208 Ga0070712_1002252083 267
85 3300025910 Ga0207684_10253076 Ga0207684_102530762 267
86 3300025915 Ga0207693_10269329 Ga0207693_102693291 267
87 3300025939 Ga0207665_10026219 Ga0207665_100262192 267
88 3300033179 Ga0307507_10040730 Ga0307507_100407306 267
89 3300039450 Ga0436363_0094958 Ga0436363_0094958_1236_2039 267
90 3300025913 Ga0207695_10075097 Ga0207695_100750972 268
91 3300036401 Ga0373937_0015836 Ga0373937_0015836_1150_1956 268
92 3300003323 rootH1_10206791 rootH1_102067911 269
93 3300005327 Ga0070658_10019895 Ga0070658_100198955 269
94 3300005329 Ga0070683_100050554 Ga0070683_1000505546 269
95 3300005339 Ga0070660_100060937 Ga0070660_1000609373 269
96 3300005344 Ga0070661_100021664 Ga0070661_1000216644 269
97 3300005366 Ga0070659_100292948 Ga0070659_1002929482 269
98 3300005535 Ga0070684_100217322 Ga0070684_1002173222 269
99 3300005539 Ga0068853_100028322 Ga0068853_1000283225 269
100 3300005578 Ga0068854_100281530 Ga0068854_1002815301 269
101 3300005614 Ga0068856_100103503 Ga0068856_1001035032 269
102 3300005616 Ga0068852_100060764 Ga0068852_1000607643 269
103 3300009545 Ga0105237_10106493 Ga0105237_101064933 269
104 3300009551 Ga0105238_10200084 Ga0105238_102000841 269
105 3300010375 Ga0105239_10097955 Ga0105239_100979554 269
106 3300013104 Ga0157370_10136641 Ga0157370_101366412 269
107 3300013105 Ga0157369_10091055 Ga0157369_100910554 269
108 3300025909 Ga0207705_10096388 Ga0207705_100963882 269
109 3300025913 Ga0207695_10021284 Ga0207695_100212841 269
110 3300025919 Ga0207657_10104991 Ga0207657_101049912 269
111 3300025920 Ga0207649_10027702 Ga0207649_100277024 269
112 3300025924 Ga0207694_10095006 Ga0207694_100950063 269
113 3300025932 Ga0207690_10156279 Ga0207690_101562792 269
114 3300025949 Ga0207667_10002347 Ga0207667_100023473 269
115 3300025981 Ga0207640_10164457 Ga0207640_101644572 269
116 3300026078 Ga0207702_10123627 Ga0207702_101236271 269
117 3300026142 Ga0207698_10092328 Ga0207698_100923282 269
118 3300048918 Ga0496115_0142981 Ga0496115_0142981_545_1354 269
119 3300005577 Ga0068857_100122962 Ga0068857_1001229623 270
120 3300006028 Ga0070717_10060752 Ga0070717_100607523 270
121 3300009147 Ga0114129_10446462 Ga0114129_104464622 270
122 3300026116 Ga0207674_10165695 Ga0207674_101656952 270
123 3300050507 nmdc:mga05p37_637033_c1 nmdc:mga05p37_637033_c1_286_1098 270
124 3300005329 Ga0070683_100017760 Ga0070683_1000177609 271
125 3300005535 Ga0070684_100469014 Ga0070684_1004690142 271
126 3300005616 Ga0068852_100389682 Ga0068852_1003896822 271
127 3300005985 Ga0081539_10000246 Ga0081539_1000024620 271
128 3300005985 Ga0081539_10029030 Ga0081539_100290303 271
129 3300005985 Ga0081539_10139139 Ga0081539_101391391 271
130 3300025944 Ga0207661_10062777 Ga0207661_100627772 271
131 3300005289 Ga0065704_10115270 Ga0065704_101152701 272
132 3300005468 Ga0070707_100134674 Ga0070707_1001346743 272
133 3300005985 Ga0081539_10005665 Ga0081539_1000566510 272
134 3300025922 Ga0207646_10253701 Ga0207646_102537011 272
135 3300005330 Ga0070690_100104063 Ga0070690_1001040632 273
136 3300005439 Ga0070711_100320528 Ga0070711_1003205282 273
137 3300007788 Ga0099795_10007949 Ga0099795_100079493 273
138 3300013297 Ga0157378_10031142 Ga0157378_100311421 273
139 3300025916 Ga0207663_10314260 Ga0207663_103142601 273
140 3300035118 Ga0373954_0035034 Ga0373954_0035034_905_1726 273
141 3300047319 Ga0495674_0168170 Ga0495674_0168170_485_1306 273
142 3300005563 Ga0068855_100119657 Ga0068855_1001196573 274
143 3300006028 Ga0070717_10174634 Ga0070717_101746342 274
144 3300009093 Ga0105240_10285707 Ga0105240_102857072 274
145 3300009098 Ga0105245_10029089 Ga0105245_100290894 274
146 3300013100 Ga0157373_10248546 Ga0157373_102485462 274
147 3300013104 Ga0157370_10214551 Ga0157370_102145512 274
148 3300013105 Ga0157369_10027342 Ga0157369_100273425 274
149 3300013307 Ga0157372_10035966 Ga0157372_100359665 274
150 3300025913 Ga0207695_10057317 Ga0207695_100573174 274
151 3300025927 Ga0207687_10006827 Ga0207687_100068276 274
152 3300025949 Ga0207667_10080721 Ga0207667_100807212 274
153 3300005467 Ga0070706_100004891 Ga0070706_1000048916 275
154 3300005467 Ga0070706_100044937 Ga0070706_1000449372 275
155 3300025910 Ga0207684_10035273 Ga0207684_100352732 275
156 3300003320 rootH2_10029275 rootH2_100292756 276
157 3300003323 rootH1_10221674 rootH1_102216743 276
158 3300005327 Ga0070658_10006408 Ga0070658_100064086 276
159 3300005329 Ga0070683_100113825 Ga0070683_1001138251 276
160 3300005366 Ga0070659_100238305 Ga0070659_1002383051 276
161 3300005458 Ga0070681_10024739 Ga0070681_100247393 276
162 3300005530 Ga0070679_100030428 Ga0070679_1000304286 276
163 3300005535 Ga0070684_100014611 Ga0070684_1000146111 276
164 3300010375 Ga0105239_10170003 Ga0105239_101700034 276
165 3300013307 Ga0157372_10062006 Ga0157372_100620061 276
166 3300025909 Ga0207705_10009953 Ga0207705_100099536 276
167 3300025912 Ga0207707_10035813 Ga0207707_100358133 276
168 3300025917 Ga0207660_10181656 Ga0207660_101816562 276
169 3300025920 Ga0207649_10064737 Ga0207649_100647374 276
170 3300025944 Ga0207661_10067611 Ga0207661_100676112 276
171 3300031730 Ga0307516_10007492 Ga0307516_100074923 276

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

55

247

0.93

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

61

280

0.88

PF08659

KR

KR domain

56

213

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fyd-assembly1.cif.gz_A structural and biochemical insights into 7beta-hydroxysteroid dehydrogenase stereoselectivity 0.9239 10 258
5fyd-assembly1.cif.gz_B structural and biochemical insights into 7beta-hydroxysteroid dehydrogenase stereoselectivity 0.917 10 258
7e24-assembly2.cif.gz_C crystal structure of sdr family nad(p)-dependent oxidoreductase from exiguobacterium 0.9155 16 240
7e3x-assembly1.cif.gz_B crystal structure of sdr family nad(p)-dependent oxidoreductase from exiguobacterium 0.9142 16 241
2ztm-assembly1.cif.gz_C t190s mutant of d-3-hydroxybutyrate dehydrogenase 0.9058 12 236
ID Description Score Start End Superfamily
af_A0A0R0HUJ2_8_65_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9502 10 65 3.40.50.720
af_A0A0P0WVK1_53_257_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9482 10 173 3.40.50.720
af_Q8SX47_51_284_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9336 9 237 3.40.50.720
af_P37058_44_264_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9327 14 228 3.40.50.720
af_Q9VJG8_44_290_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.931 9 247 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2T6E9N6-F1-model_v4 Short-chain dehydrogenase 0.9874 8 263 GO:0016491
AF-A0A1A0LC44-F1-model_v4 deleted 0.9869 6 269
AF-A0A5E7YFI9-F1-model_v4 Short-chain dehydrogenase 0.9853 5 263 GO:0016491
AF-A0A1A0LC44-F1-model_v4 deleted 0.9795 6 269
AF-A0A1F2WQQ7-F1-model_v4 Short-chain dehydrogenase 0.9773 10 193 GO:0016020
GO:0016491

Feature Viewer

pLDDT pTM Quality
89.22 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map