F258720

General Info

Members Datasets Scaffolds Average Seq Length
171 97 342 115

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10662337|Ga0105249_106623372
Length 133
Sequence MRGKIGDKERLGHILDAITEIENYTADVELKGFLANSMMRFASIKQIEIIGEAANYITPETKALFSDIEWKQIVGMRHILIHEYFGVDSNLVWQVIQNDIPNLKIAIININEGLDKSGGNSFNQNENDSARST

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
30 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
31 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
37 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
58 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
59 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
60 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
61 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
62 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
63 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
64 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
65 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
66 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
67 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
68 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
69 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
70 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
71 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
72 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
73 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
74 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
75 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
76 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
77 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
78 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
83 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
84 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
85 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
86 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
87 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
88 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
89 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
90 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
91 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
92 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
93 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
94 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
95 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
96 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
97 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.25
Metatranscriptomes 0
Isolates 1.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.02
Nodule 0
Rhizoplane 0
Rhizosphere 86.55
Stem 0
Stem Tuber 0
Unclassified 16.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_10662337 3300009553 Bacteria 1102
2 rootL2_10029222 3300003322 Bacteria 1939
3 rootL2_10372242 3300003322 Bacteria 1072
4 Ga0070658_10350061 3300005327 Bacteria 1264
5 Ga0070658_11573141 3300005327 Bacteria 570
6 Ga0070683_100072176 3300005329 Bacteria 3222
7 Ga0070680_100061492 3300005336 Bacteria 3074
8 Ga0070680_100555183 3300005336 Bacteria 984
9 Ga0070682_100028202 3300005337 Unclassified 3375
10 Ga0070660_100084934 3300005339 Unclassified 2489
11 Ga0070660_100592716 3300005339 Bacteria 926
12 Ga0070691_10002203 3300005341 Bacteria 8623
13 Ga0070692_10789302 3300005345 Bacteria 647
14 Ga0070692_11107396 3300005345 Bacteria 559
15 Ga0070659_100061108 3300005366 Bacteria 2977
16 Ga0070659_100442323 3300005366 Bacteria 1102
17 Ga0070681_10103181 3300005458 Bacteria 2796
18 Ga0070681_10176826 3300005458 Bacteria 2056
19 Ga0070679_100101913 3300005530 Bacteria 2857
20 Ga0070679_100423594 3300005530 Bacteria 1276
21 Ga0070684_100373125 3300005535 Bacteria 1314
22 Ga0070693_100004996 3300005547 Bacteria 6336
23 Ga0070665_100000016 3300005548 Bacteria 451538
24 Ga0070665_101668275 3300005548 Bacteria 645
25 Ga0068855_100000021 3300005563 Bacteria 195708
26 Ga0068855_100000381 3300005563 Bacteria 54655
27 Ga0068855_100047809 3300005563 Bacteria 5053
28 Ga0068855_100321119 3300005563 Unclassified 1711
29 Ga0068855_100359183 3300005563 Bacteria 1603
30 Ga0068855_100564582 3300005563 Bacteria 1231
31 Ga0068857_100744322 3300005577 Bacteria 933
32 Ga0068857_100932683 3300005577 Bacteria 833
33 Ga0068854_100253864 3300005578 Unclassified 1405
34 Ga0068854_100285116 3300005578 Bacteria 1331
35 Ga0068856_100030447 3300005614 Bacteria 5275
36 Ga0068856_100259719 3300005614 Bacteria 1752
37 Ga0068856_101064779 3300005614 Bacteria 826
38 Ga0068852_100091118 3300005616 Bacteria 2728
39 Ga0068860_101020603 3300005843 Bacteria 845
40 Ga0068871_101337396 3300006358 Bacteria 674
41 Ga0075430_101354025 3300006846 Unclassified 585
42 Ga0105240_10001403 3300009093 Bacteria 41363
43 Ga0105240_10007341 3300009093 Bacteria 16036
44 Ga0105240_10021505 3300009093 Bacteria 8578
45 Ga0105240_10033133 3300009093 Bacteria 6678
46 Ga0105240_10841542 3300009093 Unclassified 991
47 Ga0105240_11004424 3300009093 Bacteria 892
48 Ga0105240_12461069 3300009093 Unclassified 539
49 Ga0105241_10028682 3300009174 Bacteria 4148
50 Ga0105241_10031439 3300009174 Bacteria 3975
51 Ga0105241_10115331 3300009174 Bacteria 2156
52 Ga0105241_10960236 3300009174 Unclassified 797
53 Ga0105237_10000021 3300009545 Bacteria 228856
54 Ga0105237_10021676 3300009545 Bacteria 6604
55 Ga0105237_10325925 3300009545 Unclassified 1540
56 Ga0105237_10819195 3300009545 Bacteria 938
57 Ga0105238_10245109 3300009551 Unclassified 1770
58 Ga0105238_10279660 3300009551 Bacteria 1650
59 Ga0105239_10002058 3300010375 Bacteria 26061
60 Ga0105239_10004378 3300010375 Bacteria 16912
61 Ga0105239_10016638 3300010375 Bacteria 8130
62 Ga0105239_10060394 3300010375 Bacteria 4161
63 Ga0105239_10535481 3300010375 Bacteria 1333
64 Ga0157373_10327345 3300013100 Bacteria 1091
65 Ga0157373_10403299 3300013100 Unclassified 980
66 Ga0157371_10055882 3300013102 Bacteria 2800
67 Ga0157370_10005913 3300013104 Bacteria 13639
68 Ga0157370_10024971 3300013104 Bacteria 5914
69 Ga0157370_10239599 3300013104 Bacteria 1678
70 Ga0157370_10298713 3300013104 Bacteria 1487
71 Ga0157369_10075264 3300013105 Bacteria 3620
72 Ga0157369_10217997 3300013105 Unclassified 1998
73 Ga0157369_10927060 3300013105 Bacteria 893
74 Ga0157374_10638714 3300013296 Bacteria 1076
75 Ga0157372_10002653 3300013307 Bacteria 19378
76 Ga0157372_10003880 3300013307 Bacteria 16063
77 Ga0157372_10059434 3300013307 Bacteria 4275
78 Ga0157372_10126530 3300013307 Bacteria 2938
79 Ga0157372_10137933 3300013307 Bacteria 2810
80 Ga0163163_10190785 3300014325 Bacteria 2098
81 Ga0209233_1001137 3300025261 Bacteria 10850
82 Ga0209455_1022355 3300025272 Bacteria 1207
83 Ga0207647_10000223 3300025904 Bacteria 46793
84 Ga0207705_10930785 3300025909 Bacteria 673
85 Ga0207705_11481957 3300025909 Bacteria 514
86 Ga0207654_10012239 3300025911 Bacteria 4393
87 Ga0207654_10069832 3300025911 Bacteria 2083
88 Ga0207707_10056728 3300025912 Bacteria 3408
89 Ga0207707_10066910 3300025912 Bacteria 3129
90 Ga0207695_10000060 3300025913 Bacteria 360217
91 Ga0207695_10000636 3300025913 Bacteria 70234
92 Ga0207695_10005402 3300025913 Bacteria 16967
93 Ga0207695_10016745 3300025913 Bacteria 8561
94 Ga0207695_10883587 3300025913 Unclassified 773
95 Ga0207671_10001218 3300025914 Bacteria 30531
96 Ga0207671_10077290 3300025914 Bacteria 2492
97 Ga0207671_10103157 3300025914 Bacteria 2163
98 Ga0207657_10067347 3300025919 Bacteria 3045
99 Ga0207652_10160972 3300025921 Unclassified 2012
100 Ga0207652_10191166 3300025921 Bacteria 1841
101 Ga0207694_10264666 3300025924 Bacteria 1409
102 Ga0207694_11073055 3300025924 Unclassified 681
103 Ga0207690_10036640 3300025932 Bacteria 3177
104 Ga0207661_10022563 3300025944 Bacteria 4743
105 Ga0207667_10000014 3300025949 Bacteria 421261
106 Ga0207667_10000084 3300025949 Bacteria 152086
107 Ga0207667_10015354 3300025949 Bacteria 8704
108 Ga0207667_10141244 3300025949 Bacteria 2479
109 Ga0207667_10297462 3300025949 Bacteria 1649
110 Ga0207667_10317382 3300025949 Bacteria 1591
111 Ga0207640_10171581 3300025981 Bacteria 1617
112 Ga0207639_10142207 3300026041 Bacteria 2000
113 Ga0207639_11886521 3300026041 Unclassified 558
114 Ga0207702_10093630 3300026078 Bacteria 2635
115 Ga0207702_10212068 3300026078 Bacteria 1801
116 Ga0207702_10802573 3300026078 Bacteria 930
117 Ga0207674_10634107 3300026116 Bacteria 1032
118 Ga0207674_10737089 3300026116 Bacteria 951
119 Ga0207698_10078702 3300026142 Bacteria 2648
120 Ga0268266_10000034 3300028379 Bacteria 354251
121 Ga0268266_10521958 3300028379 Bacteria 1136
122 Ga0268264_11542290 3300028381 Unclassified 675
123 Ga0307511_10000429 3300030521 Bacteria 44853
124 Ga0307513_10074965 3300031456 Bacteria 3516
125 Ga0307513_10202877 3300031456 Bacteria 1822
126 Ga0307509_10017418 3300031507 Bacteria 8271
127 Ga0307509_10215586 3300031507 Bacteria 1739
128 Ga0307510_10003191 3300033180 Bacteria 19036
129 Ga0395900_0001378 3300037418 Bacteria 29221
130 Ga0395900_1256694 3300037418 Unclassified 655
131 Ga0395898_0001155 3300037466 Bacteria 40306
132 Ga0395901_0009161 3300038443 Bacteria 10027
133 Ga0450897_013212 3300042128 Unclassified 822
134 Ga0450894_038084 3300042131 Unclassified 685
135 Ga0450910_063124 3300042147 Unclassified 628
136 Ga0466972_0322906 3300044658 Bacteria 721
137 Ga0466966_0000366 3300044684 Bacteria 29439
138 Ga0466961_0283672 3300044693 Bacteria 1013
139 Ga0466959_0000053 3300045049 Bacteria 81055
140 Ga0466959_0526783 3300045049 Unclassified 798
141 Ga0495650_0115332 3300046471 Bacteria 993
142 Ga0495583_0184344 3300046506 Bacteria 853
143 Ga0495652_0183956 3300046529 Bacteria 1601
144 Ga0495622_0121226 3300046557 Bacteria 1194
145 Ga0495611_0006509 3300046648 Bacteria 4977
146 Ga0495625_0555316 3300046660 Unclassified 695
147 Ga0495687_002777 3300047443 Bacteria 13547
148 Ga0495687_037634 3300047443 Bacteria 2154
149 Ga0501032_0442780 3300049569 Unclassified 833
150 Ga0501033_0024864 3300049570 Bacteria 4516
151 Ga0501034_0136409 3300049571 Bacteria 2435
152 Ga0501034_0455757 3300049571 Unclassified 1196
153 Ga0501047_0017118 3300049581 Bacteria 6933
154 Ga0501047_0707036 3300049581 Unclassified 825
155 Ga0501219_000052 3300049703 Bacteria 18661
156 Ga0501241_004495 3300049758 Bacteria 2614
157 Ga0501035_0564551 3300049822 Bacteria 931
158 Ga0501284_00029 3300050005 Bacteria 74818
159 Ga0500644_0042238 3300053088 Unclassified 1519
160 Ga0500646_0335486 3300053090 Unclassified 548
161 Ga0500646_0369962 3300053090 Bacteria 525
162 Ga0500654_216625 3300053099 Unclassified 553
163 Ga0500594_0048303 3300053118 Bacteria 1190
164 Ga0500608_060315 3300053122 Bacteria 1814
165 Ga0500618_000412 3300053125 Bacteria 28963
166 Ga0500568_0071298 3300053139 Bacteria 1330
167 Ga0500616_0012084 3300053153 Bacteria 5066
168 Ga0500634_0278797 3300053161 Bacteria 676
169 2819677051 2818991460 Bacteria 7595395
170 2842907085 2842903701 Bacteria 6986368
171 8003153001 8003151029 Bacteria 8187759
172 Ga0105249_10662337
173 rootL2_10029222
174 rootL2_10372242
175 Ga0070658_10350061
176 Ga0070658_11573141
177 Ga0070683_100072176
178 Ga0070680_100061492
179 Ga0070680_100555183
180 Ga0070682_100028202
181 Ga0070660_100084934
182 Ga0070660_100592716
183 Ga0070691_10002203
184 Ga0070692_10789302
185 Ga0070692_11107396
186 Ga0070659_100061108
187 Ga0070659_100442323
188 Ga0070681_10103181
189 Ga0070681_10176826
190 Ga0070679_100101913
191 Ga0070679_100423594
192 Ga0070684_100373125
193 Ga0070693_100004996
194 Ga0070665_100000016
195 Ga0070665_101668275
196 Ga0068855_100000021
197 Ga0068855_100000381
198 Ga0068855_100047809
199 Ga0068855_100321119
200 Ga0068855_100359183
201 Ga0068855_100564582
202 Ga0068857_100744322
203 Ga0068857_100932683
204 Ga0068854_100253864
205 Ga0068854_100285116
206 Ga0068856_100030447
207 Ga0068856_100259719
208 Ga0068856_101064779
209 Ga0068852_100091118
210 Ga0068860_101020603
211 Ga0068871_101337396
212 Ga0075430_101354025
213 Ga0105240_10001403
214 Ga0105240_10007341
215 Ga0105240_10021505
216 Ga0105240_10033133
217 Ga0105240_10841542
218 Ga0105240_11004424
219 Ga0105240_12461069
220 Ga0105241_10028682
221 Ga0105241_10031439
222 Ga0105241_10115331
223 Ga0105241_10960236
224 Ga0105237_10000021
225 Ga0105237_10021676
226 Ga0105237_10325925
227 Ga0105237_10819195
228 Ga0105238_10245109
229 Ga0105238_10279660
230 Ga0105239_10002058
231 Ga0105239_10004378
232 Ga0105239_10016638
233 Ga0105239_10060394
234 Ga0105239_10535481
235 Ga0157373_10327345
236 Ga0157373_10403299
237 Ga0157371_10055882
238 Ga0157370_10005913
239 Ga0157370_10024971
240 Ga0157370_10239599
241 Ga0157370_10298713
242 Ga0157369_10075264
243 Ga0157369_10217997
244 Ga0157369_10927060
245 Ga0157374_10638714
246 Ga0157372_10002653
247 Ga0157372_10003880
248 Ga0157372_10059434
249 Ga0157372_10126530
250 Ga0157372_10137933
251 Ga0163163_10190785
252 Ga0209233_1001137
253 Ga0209455_1022355
254 Ga0207647_10000223
255 Ga0207705_10930785
256 Ga0207705_11481957
257 Ga0207654_10012239
258 Ga0207654_10069832
259 Ga0207707_10056728
260 Ga0207707_10066910
261 Ga0207695_10000060
262 Ga0207695_10000636
263 Ga0207695_10005402
264 Ga0207695_10016745
265 Ga0207695_10883587
266 Ga0207671_10001218
267 Ga0207671_10077290
268 Ga0207671_10103157
269 Ga0207657_10067347
270 Ga0207652_10160972
271 Ga0207652_10191166
272 Ga0207694_10264666
273 Ga0207694_11073055
274 Ga0207690_10036640
275 Ga0207661_10022563
276 Ga0207667_10000014
277 Ga0207667_10000084
278 Ga0207667_10015354
279 Ga0207667_10141244
280 Ga0207667_10297462
281 Ga0207667_10317382
282 Ga0207640_10171581
283 Ga0207639_10142207
284 Ga0207639_11886521
285 Ga0207702_10093630
286 Ga0207702_10212068
287 Ga0207702_10802573
288 Ga0207674_10634107
289 Ga0207674_10737089
290 Ga0207698_10078702
291 Ga0268266_10000034
292 Ga0268266_10521958
293 Ga0268264_11542290
294 Ga0307511_10000429
295 Ga0307513_10074965
296 Ga0307513_10202877
297 Ga0307509_10017418
298 Ga0307509_10215586
299 Ga0307510_10003191
300 Ga0395900_0001378
301 Ga0395900_1256694
302 Ga0395898_0001155
303 Ga0395901_0009161
304 Ga0450897_013212
305 Ga0450894_038084
306 Ga0450910_063124
307 Ga0466972_0322906
308 Ga0466966_0000366
309 Ga0466961_0283672
310 Ga0466959_0000053
311 Ga0466959_0526783
312 Ga0495650_0115332
313 Ga0495583_0184344
314 Ga0495652_0183956
315 Ga0495622_0121226
316 Ga0495611_0006509
317 Ga0495625_0555316
318 Ga0495687_002777
319 Ga0495687_037634
320 Ga0501032_0442780
321 Ga0501033_0024864
322 Ga0501034_0136409
323 Ga0501034_0455757
324 Ga0501047_0017118
325 Ga0501047_0707036
326 Ga0501219_000052
327 Ga0501241_004495
328 Ga0501035_0564551
329 Ga0501284_00029
330 Ga0500644_0042238
331 Ga0500646_0335486
332 Ga0500646_0369962
333 Ga0500654_216625
334 Ga0500594_0048303
335 Ga0500608_060315
336 Ga0500618_000412
337 Ga0500568_0071298
338 Ga0500616_0012084
339 Ga0500634_0278797
340 2819677051
341 2842907085
342 8003153001

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01934

HepT-like

Ribonuclease HepT-like

14

110

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bxo-assembly1.cif.gz_C crystal structure of the toxin-antitoxin with amp-pnp 0.7306 10 113
7ae8-assembly2.cif.gz_D crystal structure of hepn(r102a) toxin 0.7063 7 114
7ae9-assembly1.cif.gz_B crystal structure of mono-ampylated hepn(r46e) toxin in complex with mnt antitoxin 0.7005 7 114
7ae9-assembly2.cif.gz_D crystal structure of mono-ampylated hepn(r46e) toxin in complex with mnt antitoxin 0.686 7 114
7ae2-assembly1.cif.gz_A-2 crystal structure of hepn(h107a-y109f) toxin in complex with mnt antitoxin 0.6698 7 115
ID Description Score Start End Superfamily
af_Q58613_1_121_1.20.120.330 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.8394 1 110 1.20.120.330
af_Q58775_1_109_1.20.120.330 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.8356 1 107 1.20.120.330
af_Q58775_1_109_1.20.120.330 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.8081 1 107 1.20.120.330
af_Q58613_1_121_1.20.120.330 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.7943 1 110 1.20.120.330
2nwbA02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.5367 10 69 1.20.58.480
ID Description Score Start End GO Terms
AF-A0A7V9JBF7-F1-model_v4 DUF86 domain-containing protein 0.8866 10 115 GO:0004540
GO:0110001
AF-A0A1F3C8U5-F1-model_v4 DUF86 domain-containing protein 0.8861 4 113 GO:0004540
GO:0110001
AF-I4AI91-F1-model_v4 DUF86 domain-containing protein 0.8853 7 115 GO:0004540
GO:0110001
AF-A0A1H9Z863-F1-model_v4 Uncharacterized conserved protein, contains HEPN domain 0.8829 4 115 GO:0004540
GO:0110001
AF-A0A1W6MLV0-F1-model_v4 DUF86 domain-containing protein 0.8827 7 112 GO:0004540
GO:0110001

Map