F257282

General Info

Members Datasets Scaffolds Average Seq Length
170 119 340 285

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0010850|Ga0466969_0010850_2959_3858
Length 299
Sequence MEVSQPLSQGGSQVPDWLSIIIRSLGALAILFVIARIMGKKQISQLSFFEYVTGITLGEIAGFMSTEMEAHFSYGVLVMLVWFLVPLALEYLTLKSKTIRDLFEGKGRILIEKGKVQEMNLRKERMTADELMELLRKKSVFRVADVEFALMEADGDLSVLLKKEHHPVTLKDLQIKTVNERQPITVISDGVVMLEGLSKAGYSPEWLEQQLQKLEVQADHVYLAQVDGYGELTADLYNDKVKQPQPKTRPMLLAALKKCQADLECFGLSVADPEAKRMYERCADELDEVVQKLKPVLKS

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
5 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
6 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
7 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
8 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
9 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
10 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
11 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
12 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
13 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
14 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
15 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
16 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
20 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
21 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
22 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
23 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
24 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
25 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
26 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
27 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
28 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
29 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
30 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
31 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
32 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
33 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
34 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
35 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
36 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
37 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
38 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
39 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
40 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
41 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
42 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
43 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
44 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
45 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
46 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
47 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
48 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
49 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
50 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
51 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
52 2643221729 Bacillus sp. Root11 Isolate Unclassified
53 2643221730 Bacillus sp. Root131 Isolate Unclassified
54 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
55 2671180694 Paenibacillus sp. A3 Isolate Unclassified
56 2684622632 Bacillus cereus 905 Isolate Unclassified
57 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
58 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
59 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
60 2738541295 Bacillus sp. OK085 Isolate Unclassified
61 2738541358 Bacillus sp. OV752 Isolate Unclassified
62 2738543006 Bacillus sp. OK077 Isolate Unclassified
63 2738543010 Bacillus sp. YR335 Isolate Unclassified
64 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
65 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
66 2818991459 Paenibacillus sp. 597 Isolate Unclassified
67 2842682962 Bacillus sp. R-72492 Isolate Unclassified
68 2849139964 Bacillus sp. R-71875 Isolate Unclassified
69 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
70 2857581216 Bacillus sp. R-71922 Isolate Unclassified
71 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
72 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
73 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
74 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
75 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
76 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
77 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
78 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
79 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
80 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
81 2919720352 Priestia megaterium 4340 Isolate Unclassified
82 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
83 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
84 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
85 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
86 2938917290 Bacillus sp. CR71 Isolate Unclassified
87 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
88 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
89 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
90 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
91 2965761152 Bacillus sp. COPE52 Isolate Unclassified
92 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
93 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
94 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
95 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
96 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
97 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
98 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
99 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
100 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
101 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
102 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
103 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
104 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
105 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
106 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
107 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
108 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
109 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
110 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
111 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
112 8022792930 Bacillus sp. Xin Isolate Rhizosphere
113 8023438354 Bacillus sp. BH2 Isolate Unclassified
114 8023444577 Bacillus sp. BH32 Isolate Unclassified
115 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
116 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
117 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
118 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
119 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 48.82
Metatranscriptomes 0
Isolates 51.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.47
Nodule 0.59
Rhizoplane 8.82
Rhizosphere 41.76
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0010850 3300044656 Bacteria 4827
2 JGI25159J45721_1008452 3300002987 Bacteria 2825
3 JGI25159J45721_1020415 3300002987 Bacteria 1277
4 JGI25151J46595_10004165 3300003187 Bacteria 7717
5 JGI25151J46595_10008810 3300003187 Bacteria 4822
6 JGI25151J46595_10010463 3300003187 Bacteria 4308
7 JGI25151J46595_10039108 3300003187 Bacteria 1756
8 JGI25151J46595_10052407 3300003187 Bacteria 1373
9 JGI25151J46595_10071820 3300003187 Bacteria 1044
10 Ga0105251_10007577 3300009011 Bacteria 6662
11 Ga0105251_10017258 3300009011 Bacteria 3875
12 Ga0105251_10066979 3300009011 Bacteria 1678
13 Ga0105251_10079138 3300009011 Bacteria 1521
14 Ga0105251_10094342 3300009011 Bacteria 1372
15 Ga0105244_10007562 3300009036 Bacteria 6899
16 Ga0105244_10025128 3300009036 Bacteria 3242
17 Ga0105244_10055665 3300009036 Bacteria 2003
18 Ga0105250_10012385 3300009092 Bacteria 3522
19 Ga0105243_10489706 3300009148 Bacteria 1162
20 Ga0105246_10021015 3300011119 Bacteria 4193
21 Ga0209566_100124 3300025225 Bacteria 97556
22 Ga0209566_101228 3300025225 Bacteria 8936
23 Ga0209147_102462 3300025229 Bacteria 4580
24 Ga0209673_1003698 3300025273 Bacteria 8781
25 Ga0209130_1002811 3300025284 Bacteria 8117
26 Ga0209130_1003995 3300025284 Bacteria 5881
27 Ga0209130_1028224 3300025284 Bacteria 1182
28 Ga0209675_1006419 3300025291 Bacteria 4717
29 Ga0209025_1002508 3300025294 Bacteria 19222
30 Ga0209025_1003262 3300025294 Bacteria 15629
31 Ga0209025_1003382 3300025294 Bacteria 15222
32 Ga0209025_1005859 3300025294 Bacteria 9827
33 Ga0209025_1007221 3300025294 Bacteria 8365
34 Ga0209025_1015147 3300025294 Bacteria 4675
35 Ga0209025_1015296 3300025294 Bacteria 4638
36 Ga0209025_1016470 3300025294 Bacteria 4357
37 Ga0209025_1018265 3300025294 Bacteria 3992
38 Ga0209025_1023185 3300025294 Bacteria 3255
39 Ga0209025_1057992 3300025294 Bacteria 1474
40 Ga0207426_1007905 3300025302 Bacteria 4382
41 Ga0207696_1001614 3300025711 Bacteria 11924
42 Ga0207696_1003615 3300025711 Bacteria 6969
43 Ga0207696_1004645 3300025711 Bacteria 5878
44 Ga0207696_1040303 3300025711 Bacteria 1369
45 Ga0207696_1058324 3300025711 Bacteria 1090
46 Ga0207655_1001622 3300025728 Bacteria 19983
47 Ga0207655_1005979 3300025728 Bacteria 8147
48 Ga0207655_1022363 3300025728 Bacteria 3172
49 Ga0207713_1009237 3300025735 Bacteria 5582
50 Ga0207713_1020334 3300025735 Bacteria 3219
51 Ga0207713_1065593 3300025735 Bacteria 1362
52 Ga0207713_1068168 3300025735 Bacteria 1324
53 Ga0237817_10173 3300030083 Bacteria 18383
54 Ga0237817_10637 3300030083 Bacteria 3369
55 Ga0307409_100052637 3300031995 Bacteria 3123
56 Ga0307416_100100045 3300032002 Bacteria 2520
57 Ga0307416_100184077 3300032002 Bacteria 1961
58 Ga0395899_0095222 3300037312 Bacteria 2154
59 Ga0237819_00283 3300038705 Bacteria 18642
60 Ga0237819_00395 3300038705 Bacteria 15201
61 Ga0466959_0009149 3300045049 Bacteria 7034
62 Ga0466967_0020775 3300045976 Bacteria 5317
63 Ga0495654_0099814 3300046530 Bacteria 1338
64 Ga0496100_0003459 3300048903 Bacteria 8236
65 Ga0496101_0000534 3300048904 Bacteria 23347
66 Ga0496101_0343267 3300048904 Bacteria 1173
67 Ga0496102_0014011 3300048905 Bacteria 6962
68 Ga0496104_0003275 3300048907 Bacteria 13971
69 Ga0496107_0024382 3300048910 Bacteria 4279
70 Ga0496108_0001737 3300048911 Bacteria 17313
71 Ga0496109_0010214 3300048912 Bacteria 8015
72 Ga0496110_0026537 3300048913 Bacteria 4958
73 Ga0496110_0055012 3300048913 Bacteria 3501
74 Ga0496111_0002743 3300048914 Bacteria 10709
75 Ga0496111_0070115 3300048914 Bacteria 2549
76 Ga0496112_0000472 3300048915 Bacteria 26897
77 Ga0496112_0177868 3300048915 Bacteria 2092
78 Ga0496113_0005080 3300048916 Bacteria 8171
79 Ga0496116_0206077 3300048919 Bacteria 1024
80 Ga0496117_0107721 3300048920 Bacteria 1745
81 Ga0496119_0081594 3300048922 Bacteria 1862
82 Ga0496122_0008655 3300048925 Bacteria 10919
83 Ga0496125_0010754 3300048928 Bacteria 9218
84 2512735084 2512564039 Bacteria 8739048
85 2524186001 2524023129 Bacteria 6762600
86 2553394382 2551306519 Bacteria 5465154
87 2563926537 2563366752 Bacteria 4961801
88 2573038545 2571042588 Bacteria 5045676
89 2580933019 2579778775 Bacteria 5360914
90 2587737664 2585428059 Bacteria 8696589
91 2587741129 2585428059 Bacteria 8696589
92 2621275489 2619619294 Bacteria 5575484
93 2644423243 2643221676 Bacteria 8119172
94 2644425201 2643221676 Bacteria 8119172
95 2644707288 2643221729 Bacteria 6621700
96 2644714245 2643221730 Bacteria 6523787
97 2672333885 2671180330 Bacteria 5521719
98 2673819056 2671180694 Bacteria 7506943
99 2685153092 2684622632 Bacteria 5380049
100 2698320097 2695420987 Bacteria 6152737
101 2705997019 2703719227 Bacteria 5631989
102 2721508247 2718218445 Bacteria 5113413
103 2738817609 2738541295 Bacteria 5730091
104 2739157134 2738541358 Bacteria 5932299
105 2739209116 2738543006 Bacteria 5904091
106 2739230813 2738543010 Bacteria 5583595
107 2816866106 2816332186 Bacteria 5331395
108 2819582411 2818991443 Bacteria 6598732
109 2819670657 2818991459 Bacteria 8736032
110 2842686195 2842682962 Bacteria 5589973
111 2849141788 2849139964 Bacteria 5613304
112 2857458524 2857453340 Bacteria 8090534
113 2857585360 2857581216 Bacteria 5522813
114 2857610019 2857609550 Bacteria 3753890
115 2864998493 2864997549 Bacteria 5139696
116 2865004593 2865002811 Bacteria 6333767
117 2881647090 2881644220 Bacteria 5302661
118 2889296016 2889295896 Bacteria 4704906
119 2889298731 2889295896 Bacteria 4704906
120 2904530075 2904524088 Bacteria 5887454
121 2904759960 2904755435 Bacteria 7986759
122 2919149434 2919143609 Bacteria 6219228
123 2919415113 2919414237 Bacteria 5429133
124 2919429241 2919425241 Bacteria 8055701
125 2919720389 2919720352 Bacteria 5986006
126 2919726370 2919720352 Bacteria 5986006
127 2928099297 2928093941 Bacteria 5965005
128 2929210731 2929206907 Bacteria 5918291
129 2929238810 2929233124 Bacteria 5948380
130 2936366971 2936361878 Bacteria 5632809
131 2938923030 2938917290 Bacteria 5914775
132 2939704203 2939702853 Bacteria 5139229
133 2947431895 2947426588 Bacteria 5357194
134 2956900653 2956897341 Bacteria 5447711
135 2962294898 2962290636 Bacteria 4072939
136 2965766426 2965761152 Bacteria 5806513
137 2971415353 2971410472 Bacteria 8311090
138 2971417441 2971410472 Bacteria 8311090
139 2977257124 2977254563 Bacteria 4828420
140 2979088803 2979083700 Bacteria 5894929
141 2980128429 2980125574 Bacteria 5567337
142 2980184243 2980182181 Bacteria 9454109
143 2981287757 2981284811 Bacteria 4641497
144 2981288231 2981284811 Bacteria 4641497
145 2981292530 2981289755 Bacteria 4641509
146 2981293052 2981289755 Bacteria 4641509
147 2981983377 2981980479 Bacteria 4641628
148 2981983806 2981980479 Bacteria 4641628
149 2981988586 2981985349 Bacteria 4641497
150 2981988726 2981985349 Bacteria 4641497
151 2990278017 2990275345 Bacteria 4887158
152 3001268048 3001267043 Bacteria 4823521
153 3001273545 3001272096 Bacteria 4729684
154 3001898273 3001892409 Bacteria 6328293
155 3006973108 3006969106 Bacteria 4739423
156 3006975462 3006973921 Bacteria 4423788
157 3006983785 3006978542 Bacteria 5328100
158 3006984990 3006984091 Bacteria 4207523
159 3006989277 3006988479 Bacteria 4767936
160 8002321332 8002317523 Bacteria 8051857
161 8022626600 8022621104 Bacteria 5241040
162 8022797740 8022792930 Bacteria 5693794
163 8023441235 8023438354 Bacteria 5779374
164 8023444430 8023438354 Bacteria 5779374
165 8023448807 8023444577 Bacteria 5661597
166 8054804714 8054795415 Bacteria 9785225
167 8055633970 8055632911 Bacteria 5283357
168 8056540126 8056533031 Bacteria 8964429
169 8057587541 8057582654 Bacteria 5218944
170 8057981925 8057977335 Bacteria 5694872
171 Ga0466969_0010850
172 JGI25159J45721_1008452
173 JGI25159J45721_1020415
174 JGI25151J46595_10004165
175 JGI25151J46595_10008810
176 JGI25151J46595_10010463
177 JGI25151J46595_10039108
178 JGI25151J46595_10052407
179 JGI25151J46595_10071820
180 Ga0105251_10007577
181 Ga0105251_10017258
182 Ga0105251_10066979
183 Ga0105251_10079138
184 Ga0105251_10094342
185 Ga0105244_10007562
186 Ga0105244_10025128
187 Ga0105244_10055665
188 Ga0105250_10012385
189 Ga0105243_10489706
190 Ga0105246_10021015
191 Ga0209566_100124
192 Ga0209566_101228
193 Ga0209147_102462
194 Ga0209673_1003698
195 Ga0209130_1002811
196 Ga0209130_1003995
197 Ga0209130_1028224
198 Ga0209675_1006419
199 Ga0209025_1002508
200 Ga0209025_1003262
201 Ga0209025_1003382
202 Ga0209025_1005859
203 Ga0209025_1007221
204 Ga0209025_1015147
205 Ga0209025_1015296
206 Ga0209025_1016470
207 Ga0209025_1018265
208 Ga0209025_1023185
209 Ga0209025_1057992
210 Ga0207426_1007905
211 Ga0207696_1001614
212 Ga0207696_1003615
213 Ga0207696_1004645
214 Ga0207696_1040303
215 Ga0207696_1058324
216 Ga0207655_1001622
217 Ga0207655_1005979
218 Ga0207655_1022363
219 Ga0207713_1009237
220 Ga0207713_1020334
221 Ga0207713_1065593
222 Ga0207713_1068168
223 Ga0237817_10173
224 Ga0237817_10637
225 Ga0307409_100052637
226 Ga0307416_100100045
227 Ga0307416_100184077
228 Ga0395899_0095222
229 Ga0237819_00283
230 Ga0237819_00395
231 Ga0466959_0009149
232 Ga0466967_0020775
233 Ga0495654_0099814
234 Ga0496100_0003459
235 Ga0496101_0000534
236 Ga0496101_0343267
237 Ga0496102_0014011
238 Ga0496104_0003275
239 Ga0496107_0024382
240 Ga0496108_0001737
241 Ga0496109_0010214
242 Ga0496110_0026537
243 Ga0496110_0055012
244 Ga0496111_0002743
245 Ga0496111_0070115
246 Ga0496112_0000472
247 Ga0496112_0177868
248 Ga0496113_0005080
249 Ga0496116_0206077
250 Ga0496117_0107721
251 Ga0496119_0081594
252 Ga0496122_0008655
253 Ga0496125_0010754
254 2512735084
255 2524186001
256 2553394382
257 2563926537
258 2573038545
259 2580933019
260 2587737664
261 2587741129
262 2621275489
263 2644423243
264 2644425201
265 2644707288
266 2644714245
267 2672333885
268 2673819056
269 2685153092
270 2698320097
271 2705997019
272 2721508247
273 2738817609
274 2739157134
275 2739209116
276 2739230813
277 2816866106
278 2819582411
279 2819670657
280 2842686195
281 2849141788
282 2857458524
283 2857585360
284 2857610019
285 2864998493
286 2865004593
287 2881647090
288 2889296016
289 2889298731
290 2904530075
291 2904759960
292 2919149434
293 2919415113
294 2919429241
295 2919720389
296 2919726370
297 2928099297
298 2929210731
299 2929238810
300 2936366971
301 2938923030
302 2939704203
303 2947431895
304 2956900653
305 2962294898
306 2965766426
307 2971415353
308 2971417441
309 2977257124
310 2979088803
311 2980128429
312 2980184243
313 2981287757
314 2981288231
315 2981292530
316 2981293052
317 2981983377
318 2981983806
319 2981988586
320 2981988726
321 2990278017
322 3001268048
323 3001273545
324 3001898273
325 3006973108
326 3006975462
327 3006983785
328 3006984990
329 3006989277
330 8002321332
331 8022626600
332 8022797740
333 8023441235
334 8023444430
335 8023448807
336 8054804714
337 8055633970
338 8056540126
339 8057587541
340 8057981925

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04239

DUF421

YetF C-terminal domain

94

227

0.98

PF07870

DUF1657

Protein of unknown function (DUF1657)

249

297

0.97

PF20730

YetF_N

YetF N-terminal transmembrane domain

17

92

0.95

Map