F257235

General Info

Members Datasets Scaffolds Average Seq Length
170 136 340 118

Family's Representative Sequence

Representative Sequence 3300041453|Ga0451797_1564960|Ga0451797_1564960_136_537
Length 133
Sequence MSRLVPVAAEKDEDEAMKFLMTYQSDSPATPEKMAAIGKFGQEMAAKGVLLMTGGLVRPNTGTKLKYEGGKHTVLDGPFPETKELIDGFALVRVASLEEAIGVGQQFMSIAGEGDAEVLRVFDASEGGPPGDP

Samples

Sample ID Description Type Environment
1 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
64 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
65 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
66 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
67 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
68 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
69 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
70 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
71 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
72 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
73 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
74 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
77 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
78 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
79 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
80 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
81 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
82 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
83 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
84 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
85 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
86 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
87 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
88 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
89 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
90 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
98 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
99 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
100 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
101 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
102 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
103 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
104 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
105 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
106 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
107 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
108 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
109 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
110 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
116 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
117 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
118 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
121 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
122 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
123 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
124 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
125 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
126 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
127 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
128 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
129 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
130 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
131 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
132 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
133 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
134 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
135 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
136 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.82
Nodule 0
Rhizoplane 4.71
Rhizosphere 80.59
Stem 0
Stem Tuber 0
Unclassified 6.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451797_1564960 3300041453 Bacteria 648
2 Ga0070682_100193170 3300005337 Bacteria 1430
3 Ga0070682_100388138 3300005337 Bacteria 1052
4 Ga0070682_100942947 3300005337 Unclassified 712
5 Ga0070682_101244097 3300005337 Unclassified 630
6 Ga0068868_100003133 3300005338 Bacteria 11511
7 Ga0070668_100055652 3300005347 Bacteria 3054
8 Ga0070675_100088663 3300005354 Bacteria 2589
9 Ga0070675_100671235 3300005354 Bacteria 943
10 Ga0070688_100352234 3300005365 Bacteria 1078
11 Ga0070701_10786891 3300005438 Bacteria 648
12 Ga0070705_100238977 3300005440 Bacteria 1268
13 Ga0070700_100231231 3300005441 Bacteria 1316
14 Ga0070700_100587211 3300005441 Bacteria 871
15 Ga0070678_100530167 3300005456 Unclassified 1043
16 Ga0068867_100015085 3300005459 Bacteria 5479
17 Ga0070685_10102965 3300005466 Bacteria 1746
18 Ga0070685_10130671 3300005466 Bacteria 1570
19 Ga0070707_101305265 3300005468 Bacteria 692
20 Ga0070698_100010248 3300005471 Bacteria 10010
21 Ga0070672_100017627 3300005543 Bacteria 5144
22 Ga0070672_100408411 3300005543 Bacteria 1165
23 Ga0070686_100350786 3300005544 Bacteria 1109
24 Ga0070693_101015952 3300005547 Bacteria 628
25 Ga0070704_101278470 3300005549 Bacteria 671
26 Ga0070704_101797500 3300005549 Bacteria 567
27 Ga0068855_100041856 3300005563 Bacteria 5429
28 Ga0068856_100254019 3300005614 Bacteria 1773
29 Ga0070702_100725041 3300005615 Bacteria 760
30 Ga0070702_101547938 3300005615 Bacteria 547
31 Ga0068852_102645547 3300005616 Unclassified 521
32 Ga0068859_101688217 3300005617 Bacteria 700
33 Ga0068864_100338618 3300005618 Bacteria 1417
34 Ga0068866_10444853 3300005718 Bacteria 846
35 Ga0068866_10642947 3300005718 Bacteria 721
36 Ga0068861_100000380 3300005719 Bacteria 25640
37 Ga0068861_100134830 3300005719 Bacteria 2008
38 Ga0068870_10344756 3300005840 Bacteria 954
39 Ga0068860_101387239 3300005843 Bacteria 724
40 Ga0081455_10266016 3300005937 Bacteria 1246
41 Ga0075366_10784935 3300006195 Unclassified 592
42 Ga0097621_100088214 3300006237 Bacteria 2592
43 Ga0068871_100583620 3300006358 Bacteria 1015
44 Ga0075429_100769918 3300006880 Bacteria 843
45 Ga0068865_100066134 3300006881 Bacteria 2550
46 Ga0097620_101167472 3300006931 Bacteria 848
47 Ga0097620_101688144 3300006931 Bacteria 700
48 Ga0075435_100792424 3300007076 Bacteria 825
49 Ga0111539_10520562 3300009094 Bacteria 1386
50 Ga0105245_10000102 3300009098 Bacteria 82611
51 Ga0105245_10325877 3300009098 Bacteria 1515
52 Ga0105242_10071862 3300009176 Bacteria 2872
53 Ga0105248_12315044 3300009177 Bacteria 612
54 Ga0105249_10144884 3300009553 Bacteria 2281
55 Ga0157374_12322645 3300013296 Bacteria 563
56 Ga0163163_10025179 3300014325 Bacteria 5671
57 Ga0157376_10006010 3300014969 Bacteria 8531
58 Ga0157376_12738260 3300014969 Bacteria 533
59 Ga0207662_10967859 3300025918 Bacteria 604
60 Ga0207659_10547219 3300025926 Bacteria 984
61 Ga0207687_10001215 3300025927 Bacteria 17663
62 Ga0207686_10033060 3300025934 Bacteria 3084
63 Ga0207670_10013075 3300025936 Bacteria 4882
64 Ga0207691_10019197 3300025940 Bacteria 6472
65 Ga0207667_10000089 3300025949 Bacteria 149275
66 Ga0207667_10020358 3300025949 Bacteria 7383
67 Ga0207712_10098025 3300025961 Bacteria 2173
68 Ga0207668_10103655 3300025972 Bacteria 2119
69 Ga0207677_10019715 3300026023 Bacteria 4079
70 Ga0207708_10176530 3300026075 Bacteria 1694
71 Ga0207702_10385663 3300026078 Bacteria 1348
72 Ga0207641_11580598 3300026088 Bacteria 658
73 Ga0207641_11834736 3300026088 Bacteria 608
74 Ga0207648_10052473 3300026089 Bacteria 3565
75 Ga0207648_10185708 3300026089 Bacteria 1841
76 Ga0207676_10309558 3300026095 Bacteria 1445
77 Ga0207675_100003510 3300026118 Bacteria 15306
78 Ga0207675_100493282 3300026118 Bacteria 1218
79 Ga0207683_10599946 3300026121 Bacteria 1019
80 Ga0268265_12055829 3300028380 Bacteria 578
81 Ga0265334_10037196 3300028573 Bacteria 1919
82 Ga0307515_10021447 3300028794 Bacteria 11456
83 Ga0307511_10352068 3300030521 Bacteria 632
84 Ga0265332_10001941 3300031238 Bacteria 10906
85 Ga0265320_10213747 3300031240 Bacteria 860
86 Ga0265339_10021098 3300031249 Bacteria 3797
87 Ga0265331_10066745 3300031250 Bacteria 1689
88 Ga0307513_10266460 3300031456 Bacteria 1499
89 Ga0307509_10809721 3300031507 Bacteria 601
90 Ga0307508_10007683 3300031616 Bacteria 10024
91 Ga0265342_10436494 3300031712 Bacteria 673
92 Ga0307516_10009180 3300031730 Bacteria 11072
93 Ga0307416_100017174 3300032002 Bacteria 5053
94 Ga0373949_0000167 3300035090 Bacteria 24953
95 Ga0373951_0176368 3300035091 Bacteria 612
96 Ga0373936_0214127 3300035113 Bacteria 853
97 Ga0373939_0132882 3300035114 Bacteria 890
98 Ga0373941_0144514 3300035115 Bacteria 867
99 Ga0373953_0008289 3300035117 Bacteria 3523
100 Ga0373953_0493085 3300035117 Unclassified 543
101 Ga0373956_0044239 3300035119 Bacteria 1984
102 Ga0373956_0103354 3300035119 Bacteria 1323
103 Ga0373957_0037099 3300035120 Bacteria 1819
104 Ga0373960_0159154 3300035121 Bacteria 776
105 Ga0373943_0623673 3300035170 Bacteria 636
106 Ga0373955_0229378 3300035172 Bacteria 1110
107 Ga0373955_0748914 3300035172 Bacteria 600
108 Ga0373924_0003621 3300035410 Bacteria 5327
109 Ga0373931_0805196 3300035691 Bacteria 627
110 Ga0373933_0028281 3300035724 Bacteria 3234
111 Ga0373933_1060970 3300035724 Bacteria 534
112 Ga0373937_0023785 3300036401 Bacteria 5523
113 Ga0373937_0024766 3300036401 Bacteria 5416
114 Ga0373937_0247529 3300036401 Bacteria 1680
115 Ga0373925_0540453 3300037068 Bacteria 958
116 Ga0373925_0999508 3300037068 Bacteria 689
117 Ga0395899_0009886 3300037312 Bacteria 7314
118 Ga0395900_1377609 3300037418 Bacteria 618
119 Ga0395898_0069174 3300037466 Bacteria 3416
120 Ga0395905_0079459 3300037471 Bacteria 3075
121 Ga0395901_0343186 3300038443 Bacteria 1542
122 Ga0451791_0503440 3300041451 Bacteria 968
123 Ga0451800_1073391 3300041459 Bacteria 631
124 Ga0451802_0512702 3300041460 Unclassified 604
125 Ga0451804_0731759 3300041463 Bacteria 557
126 Ga0451807_0425422 3300041486 Bacteria 1202
127 Ga0451807_1803662 3300041486 Bacteria 670
128 Ga0451833_0916503 3300041491 Bacteria 593
129 Ga0451837_0063758 3300041494 Bacteria 765
130 Ga0451843_1124688 3300041509 Unclassified 751
131 Ga0451853_3028768 3300041512 Bacteria 585
132 Ga0466960_0139760 3300044901 Bacteria 1285
133 Ga0466960_0453322 3300044901 Bacteria 746
134 Ga0495641_0414279 3300046461 Bacteria 612
135 Ga0495643_0371673 3300046522 Bacteria 636
136 Ga0495658_0574541 3300046683 Bacteria 722
137 Ga0495649_0120297 3300046694 Bacteria 1389
138 Ga0496112_1451224 3300048915 Unclassified 600
139 Ga0501042_0039151 3300049578 Bacteria 3368
140 Ga0501043_0396012 3300049579 Bacteria 1044
141 Ga0501047_0712800 3300049581 Bacteria 820
142 Ga0501068_0370489 3300049584 Unclassified 921
143 Ga0501071_0065663 3300049587 Bacteria 2635
144 Ga0501074_1238785 3300049590 Bacteria 523
145 Ga0501035_0077473 3300049822 Bacteria 2938
146 Ga0501035_0239666 3300049822 Bacteria 1543
147 Ga0501035_0794604 3300049822 Bacteria 756
148 Ga0501044_0299136 3300049823 Bacteria 1538
149 nmdc:mga0k408_196737_c1 3300050493 Bacteria 1203
150 nmdc:mga0k408_613836_c1 3300050493 Bacteria 641
151 nmdc:mga0k408_862531_c1 3300050493 Bacteria 526
152 nmdc:mga0k408_89847_c1 3300050493 Bacteria 1804
153 nmdc:mga08y16_710306_c1 3300050511 Bacteria 1004
154 nmdc:mga0rr50_896211_c1 3300050513 Bacteria 756
155 Ga0495595_0097037 3300053084 Bacteria 1419
156 Ga0495619_0282267 3300053085 Bacteria 1151
157 Ga0500583_0138725 3300053092 Bacteria 1208
158 Ga0500555_119866 3300053103 Bacteria 658
159 Ga0500597_317536 3300053120 Bacteria 616
160 Ga0500614_001358 3300053123 Bacteria 5891
161 Ga0500642_0333400 3300053130 Bacteria 677
162 Ga0500616_0102213 3300053153 Bacteria 1399
163 Ga0500616_0221335 3300053153 Bacteria 825
164 Ga0500636_0389855 3300053177 Bacteria 650
165 Ga0500637_0043849 3300053178 Bacteria 2534
166 Ga0501084_0084008 3300054114 Bacteria 2673
167 Ga0500661_017038 3300055283 Bacteria 1298
168 Ga0501082_0146349 3300060353 Bacteria 2051
169 Ga0501082_0632623 3300060353 Bacteria 936
170 Ga0530510_1219505 3300061734 Unclassified 577
171 Ga0451797_1564960
172 Ga0070682_100193170
173 Ga0070682_100388138
174 Ga0070682_100942947
175 Ga0070682_101244097
176 Ga0068868_100003133
177 Ga0070668_100055652
178 Ga0070675_100088663
179 Ga0070675_100671235
180 Ga0070688_100352234
181 Ga0070701_10786891
182 Ga0070705_100238977
183 Ga0070700_100231231
184 Ga0070700_100587211
185 Ga0070678_100530167
186 Ga0068867_100015085
187 Ga0070685_10102965
188 Ga0070685_10130671
189 Ga0070707_101305265
190 Ga0070698_100010248
191 Ga0070672_100017627
192 Ga0070672_100408411
193 Ga0070686_100350786
194 Ga0070693_101015952
195 Ga0070704_101278470
196 Ga0070704_101797500
197 Ga0068855_100041856
198 Ga0068856_100254019
199 Ga0070702_100725041
200 Ga0070702_101547938
201 Ga0068852_102645547
202 Ga0068859_101688217
203 Ga0068864_100338618
204 Ga0068866_10444853
205 Ga0068866_10642947
206 Ga0068861_100000380
207 Ga0068861_100134830
208 Ga0068870_10344756
209 Ga0068860_101387239
210 Ga0081455_10266016
211 Ga0075366_10784935
212 Ga0097621_100088214
213 Ga0068871_100583620
214 Ga0075429_100769918
215 Ga0068865_100066134
216 Ga0097620_101167472
217 Ga0097620_101688144
218 Ga0075435_100792424
219 Ga0111539_10520562
220 Ga0105245_10000102
221 Ga0105245_10325877
222 Ga0105242_10071862
223 Ga0105248_12315044
224 Ga0105249_10144884
225 Ga0157374_12322645
226 Ga0163163_10025179
227 Ga0157376_10006010
228 Ga0157376_12738260
229 Ga0207662_10967859
230 Ga0207659_10547219
231 Ga0207687_10001215
232 Ga0207686_10033060
233 Ga0207670_10013075
234 Ga0207691_10019197
235 Ga0207667_10000089
236 Ga0207667_10020358
237 Ga0207712_10098025
238 Ga0207668_10103655
239 Ga0207677_10019715
240 Ga0207708_10176530
241 Ga0207702_10385663
242 Ga0207641_11580598
243 Ga0207641_11834736
244 Ga0207648_10052473
245 Ga0207648_10185708
246 Ga0207676_10309558
247 Ga0207675_100003510
248 Ga0207675_100493282
249 Ga0207683_10599946
250 Ga0268265_12055829
251 Ga0265334_10037196
252 Ga0307515_10021447
253 Ga0307511_10352068
254 Ga0265332_10001941
255 Ga0265320_10213747
256 Ga0265339_10021098
257 Ga0265331_10066745
258 Ga0307513_10266460
259 Ga0307509_10809721
260 Ga0307508_10007683
261 Ga0265342_10436494
262 Ga0307516_10009180
263 Ga0307416_100017174
264 Ga0373949_0000167
265 Ga0373951_0176368
266 Ga0373936_0214127
267 Ga0373939_0132882
268 Ga0373941_0144514
269 Ga0373953_0008289
270 Ga0373953_0493085
271 Ga0373956_0044239
272 Ga0373956_0103354
273 Ga0373957_0037099
274 Ga0373960_0159154
275 Ga0373943_0623673
276 Ga0373955_0229378
277 Ga0373955_0748914
278 Ga0373924_0003621
279 Ga0373931_0805196
280 Ga0373933_0028281
281 Ga0373933_1060970
282 Ga0373937_0023785
283 Ga0373937_0024766
284 Ga0373937_0247529
285 Ga0373925_0540453
286 Ga0373925_0999508
287 Ga0395899_0009886
288 Ga0395900_1377609
289 Ga0395898_0069174
290 Ga0395905_0079459
291 Ga0395901_0343186
292 Ga0451791_0503440
293 Ga0451800_1073391
294 Ga0451802_0512702
295 Ga0451804_0731759
296 Ga0451807_0425422
297 Ga0451807_1803662
298 Ga0451833_0916503
299 Ga0451837_0063758
300 Ga0451843_1124688
301 Ga0451853_3028768
302 Ga0466960_0139760
303 Ga0466960_0453322
304 Ga0495641_0414279
305 Ga0495643_0371673
306 Ga0495658_0574541
307 Ga0495649_0120297
308 Ga0496112_1451224
309 Ga0501042_0039151
310 Ga0501043_0396012
311 Ga0501047_0712800
312 Ga0501068_0370489
313 Ga0501071_0065663
314 Ga0501074_1238785
315 Ga0501035_0077473
316 Ga0501035_0239666
317 Ga0501035_0794604
318 Ga0501044_0299136
319 nmdc:mga0k408_196737_c1
320 nmdc:mga0k408_613836_c1
321 nmdc:mga0k408_862531_c1
322 nmdc:mga0k408_89847_c1
323 nmdc:mga08y16_710306_c1
324 nmdc:mga0rr50_896211_c1
325 Ga0495595_0097037
326 Ga0495619_0282267
327 Ga0500583_0138725
328 Ga0500555_119866
329 Ga0500597_317536
330 Ga0500614_001358
331 Ga0500642_0333400
332 Ga0500616_0102213
333 Ga0500616_0221335
334 Ga0500636_0389855
335 Ga0500637_0043849
336 Ga0501084_0084008
337 Ga0500661_017038
338 Ga0501082_0146349
339 Ga0501082_0632623
340 Ga0530510_1219505

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

10

124

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fpi-assembly1.cif.gz_E crystal structure of 5-chloromuconolactone isomerase from rhodococcus opacus 1cp 0.7177 1 116
3zo7-assembly1.cif.gz_E crystal structure of clcfe27a with substrate 0.7119 1 112
3zo7-assembly1.cif.gz_F crystal structure of clcfe27a with substrate 0.7057 1 112
4fpi-assembly1.cif.gz_E crystal structure of 5-chloromuconolactone isomerase from rhodococcus opacus 1cp 0.7036 1 116
3znu-assembly1.cif.gz_I crystal structure of clcf in crystal form 2 0.6927 1 112
ID Description Score Start End Superfamily
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7135 1 112 3.30.70.1060
af_O07243_108_202_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7091 2 112 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6811 1 112 3.30.70.1060
3znj100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6746 1 116 3.30.70.1060
af_O07243_108_202_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6649 2 112 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A7Y6UEB8-F1-model_v4 YCII-related domain-containing protein 0.846 1 109
AF-A0A7Y6UEB8-F1-model_v4 YCII-related domain-containing protein 0.7926 1 109
AF-A0A2V9YRW0-F1-model_v4 Dehydrogenase 0.7297 1 109
AF-A0A7Y6Q093-F1-model_v4 YCII-related domain-containing protein 0.7249 1 116
AF-A0A7Y6Q093-F1-model_v4 YCII-related domain-containing protein 0.7188 1 116

Map