F257144
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 170 | 25 | 324 | 219 |
Family's Representative Sequence
| Representative Sequence | 3300035398|Ga0316574_0081935|Ga0316574_0081935_804_1535 |
| Length | 243 |
| Sequence | LSHLIRPSDGWVLLLQKLTESEEPAMPKIFIRELDNIKKMTLSLGAMVEERVRLAVEAVENKDAEAAQRVIKTDYEIDEMEVEVEETCLKVLALHQPVAVDLRFLIAVIKINNDLERIGDQAVNIAQRVAVLAKRHDVNFNFDYAQMAEKAQAMLRMSLDALVNLDEDLALKVVTMDDEVDAIQRDAYDRIKSAMKENSDKIGYMINLLLVSRHLERLADHATNIAEEVIYLIEGEIIRHGNY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 2 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 3 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 4 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 5 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 6 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 7 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 8 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 9 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 10 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 11 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 12 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 13 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 14 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 15 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 16 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 17 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 18 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 19 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 20 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 21 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 22 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 23 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 24 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 25 | 2740891818 | Desulfofaba hansenii DSM 12642 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.41 |
| Metatranscriptomes | 0 |
| Isolates | 0.59 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 73.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0316574_0081935 | 3300035398 | Unclassified | 2050 |
| 2 | Ga0316575_10000780 | 3300031665 | Bacteria | 9648 |
| 3 | Ga0316575_10000864 | 3300031665 | Bacteria | 9305 |
| 4 | Ga0316575_10003526 | 3300031665 | Bacteria | 5402 |
| 5 | Ga0316575_10006608 | 3300031665 | Bacteria | 4178 |
| 6 | Ga0316575_10025158 | 3300031665 | Bacteria | 2307 |
| 7 | Ga0316575_10105079 | 3300031665 | Bacteria | 1150 |
| 8 | Ga0316575_10136826 | 3300031665 | Bacteria | 1007 |
| 9 | Ga0316575_10269810 | 3300031665 | Unclassified | 716 |
| 10 | Ga0316579_10004284 | 3300031691 | Bacteria | 5656 |
| 11 | Ga0316579_10007446 | 3300031691 | Bacteria | 4521 |
| 12 | Ga0316579_10008122 | 3300031691 | Unclassified | 4364 |
| 13 | Ga0316579_10031325 | 3300031691 | Bacteria | 2434 |
| 14 | Ga0316579_10062537 | 3300031691 | Bacteria | 1753 |
| 15 | Ga0316579_10098390 | 3300031691 | Bacteria | 1399 |
| 16 | Ga0316579_10112381 | 3300031691 | Unclassified | 1307 |
| 17 | Ga0316579_10122754 | 3300031691 | Bacteria | 1249 |
| 18 | Ga0316579_10162271 | 3300031691 | Bacteria | 1080 |
| 19 | Ga0316576_10000928 | 3300031727 | Bacteria | 14960 |
| 20 | Ga0316576_10003702 | 3300031727 | Bacteria | 9025 |
| 21 | Ga0316576_10004533 | 3300031727 | Bacteria | 8349 |
| 22 | Ga0316576_10025873 | 3300031727 | Bacteria | 4112 |
| 23 | Ga0316576_10028902 | 3300031727 | Bacteria | 3913 |
| 24 | Ga0316576_10032008 | 3300031727 | Bacteria | 3736 |
| 25 | Ga0316576_10041588 | 3300031727 | Bacteria | 3309 |
| 26 | Ga0316576_10061388 | 3300031727 | Unclassified | 2755 |
| 27 | Ga0316576_10069020 | 3300031727 | Unclassified | 2605 |
| 28 | Ga0316576_10111300 | 3300031727 | Bacteria | 2052 |
| 29 | Ga0316576_10121733 | 3300031727 | Bacteria | 1959 |
| 30 | Ga0316576_10166823 | 3300031727 | Unclassified | 1661 |
| 31 | Ga0316576_10267491 | 3300031727 | Bacteria | 1282 |
| 32 | Ga0316576_10323112 | 3300031727 | Bacteria | 1151 |
| 33 | Ga0316578_10008233 | 3300031728 | Bacteria | 5292 |
| 34 | Ga0316578_10019908 | 3300031728 | Unclassified | 3701 |
| 35 | Ga0316578_10019962 | 3300031728 | Bacteria | 3697 |
| 36 | Ga0316578_10085791 | 3300031728 | Bacteria | 1876 |
| 37 | Ga0316578_10125163 | 3300031728 | Bacteria | 1545 |
| 38 | Ga0316578_10175797 | 3300031728 | Bacteria | 1290 |
| 39 | Ga0316577_10000520 | 3300031733 | Bacteria | 15441 |
| 40 | Ga0316577_10011946 | 3300031733 | Bacteria | 4719 |
| 41 | Ga0316577_10060240 | 3300031733 | Bacteria | 2119 |
| 42 | Ga0316577_10151213 | 3300031733 | Bacteria | 1308 |
| 43 | Ga0316577_10394309 | 3300031733 | Bacteria | 786 |
| 44 | Ga0316583_10000188 | 3300032133 | Bacteria | 15985 |
| 45 | Ga0316583_10000898 | 3300032133 | Bacteria | 9543 |
| 46 | Ga0316583_10001255 | 3300032133 | Bacteria | 8366 |
| 47 | Ga0316583_10007982 | 3300032133 | Bacteria | 3814 |
| 48 | Ga0316583_10022650 | 3300032133 | Bacteria | 2249 |
| 49 | Ga0316583_10026112 | 3300032133 | Bacteria | 2084 |
| 50 | Ga0316583_10165256 | 3300032133 | Bacteria | 770 |
| 51 | Ga0316583_10185694 | 3300032133 | Bacteria | 722 |
| 52 | Ga0316585_10002620 | 3300032137 | Unclassified | 4874 |
| 53 | Ga0316585_10005420 | 3300032137 | Bacteria | 3600 |
| 54 | Ga0316585_10010006 | 3300032137 | Bacteria | 2777 |
| 55 | Ga0316585_10017358 | 3300032137 | Bacteria | 2176 |
| 56 | Ga0316585_10018394 | 3300032137 | Bacteria | 2120 |
| 57 | Ga0316585_10042214 | 3300032137 | Bacteria | 1454 |
| 58 | Ga0316585_10061497 | 3300032137 | Unclassified | 1213 |
| 59 | Ga0316585_10084310 | 3300032137 | Bacteria | 1036 |
| 60 | Ga0316585_10156225 | 3300032137 | Unclassified | 753 |
| 61 | Ga0316580_10000854 | 3300032139 | Bacteria | 7491 |
| 62 | Ga0316580_10001729 | 3300032139 | Bacteria | 5821 |
| 63 | Ga0316580_10033096 | 3300032139 | Bacteria | 1600 |
| 64 | Ga0316580_10064093 | 3300032139 | Bacteria | 1127 |
| 65 | Ga0316574_0000019 | 3300035398 | Bacteria | 40791 |
| 66 | Ga0316574_0003420 | 3300035398 | Bacteria | 8178 |
| 67 | Ga0316574_0004576 | 3300035398 | Bacteria | 7265 |
| 68 | Ga0316574_0006747 | 3300035398 | Bacteria | 6235 |
| 69 | Ga0316574_0044430 | 3300035398 | Bacteria | 2748 |
| 70 | Ga0316574_0060770 | 3300035398 | Bacteria | 2372 |
| 71 | Ga0316574_0082598 | 3300035398 | Bacteria | 2041 |
| 72 | Ga0316574_0134373 | 3300035398 | Bacteria | 1593 |
| 73 | Ga0316574_0299028 | 3300035398 | Bacteria | 1024 |
| 74 | Ga0316574_0413261 | 3300035398 | Bacteria | 848 |
| 75 | Ga0316582_0007344 | 3300036647 | Bacteria | 5861 |
| 76 | Ga0316582_0027167 | 3300036647 | Bacteria | 3453 |
| 77 | Ga0316582_0067440 | 3300036647 | Bacteria | 2308 |
| 78 | Ga0316582_0078210 | 3300036647 | Bacteria | 2154 |
| 79 | Ga0316582_0085639 | 3300036647 | Bacteria | 2065 |
| 80 | Ga0316582_0088901 | 3300036647 | Bacteria | 2030 |
| 81 | Ga0316582_0108130 | 3300036647 | Bacteria | 1848 |
| 82 | Ga0316582_0154740 | 3300036647 | Bacteria | 1551 |
| 83 | Ga0316582_0170807 | 3300036647 | Bacteria | 1476 |
| 84 | Ga0316582_0214529 | 3300036647 | Bacteria | 1315 |
| 85 | Ga0316582_0269807 | 3300036647 | Bacteria | 1167 |
| 86 | Ga0316582_0320532 | 3300036647 | Bacteria | 1065 |
| 87 | Ga0316584_0000241 | 3300036712 | Bacteria | 27284 |
| 88 | Ga0316584_0000858 | 3300036712 | Bacteria | 17246 |
| 89 | Ga0316584_0005779 | 3300036712 | Bacteria | 8339 |
| 90 | Ga0316584_0014345 | 3300036712 | Bacteria | 5636 |
| 91 | Ga0316584_0021387 | 3300036712 | Unclassified | 4700 |
| 92 | Ga0316584_0034165 | 3300036712 | Bacteria | 3769 |
| 93 | Ga0316584_0085531 | 3300036712 | Bacteria | 2361 |
| 94 | Ga0316584_0099820 | 3300036712 | Bacteria | 2174 |
| 95 | Ga0316584_0100611 | 3300036712 | Bacteria | 2164 |
| 96 | Ga0316584_0104549 | 3300036712 | Bacteria | 2119 |
| 97 | Ga0316584_0114074 | 3300036712 | Unclassified | 2021 |
| 98 | Ga0316584_0152683 | 3300036712 | Bacteria | 1718 |
| 99 | Ga0316584_0182307 | 3300036712 | Bacteria | 1554 |
| 100 | Ga0316584_0225965 | 3300036712 | Bacteria | 1373 |
| 101 | Ga0316584_0257568 | 3300036712 | Bacteria | 1273 |
| 102 | Ga0316584_0499441 | 3300036712 | Bacteria | 855 |
| 103 | Ga0316584_0656398 | 3300036712 | Unclassified | 723 |
| 104 | Ga0316584_0698279 | 3300036712 | Unclassified | 696 |
| 105 | Ga0316581_0004849 | 3300037588 | Bacteria | 3463 |
| 106 | Ga0316581_0030471 | 3300037588 | Bacteria | 1624 |
| 107 | Ga0316581_0052019 | 3300037588 | Bacteria | 1255 |
| 108 | Ga0316581_0089448 | 3300037588 | Bacteria | 948 |
| 109 | Ga0400484_02496 | 3300038725 | Bacteria | 9116 |
| 110 | Ga0400484_05847 | 3300038725 | Bacteria | 8312 |
| 111 | Ga0400484_27748 | 3300038725 | Bacteria | 4292 |
| 112 | Ga0400484_28725 | 3300038725 | Bacteria | 1317 |
| 113 | Ga0400484_39203 | 3300038725 | Bacteria | 17902 |
| 114 | Ga0400490_22704 | 3300038726 | Bacteria | 1579 |
| 115 | Ga0400490_55438 | 3300038726 | Bacteria | 21195 |
| 116 | Ga0400491_04737 | 3300038727 | Bacteria | 2270 |
| 117 | Ga0400491_10952 | 3300038727 | Bacteria | 2975 |
| 118 | Ga0400485_01986 | 3300038735 | Bacteria | 15643 |
| 119 | Ga0400485_16211 | 3300038735 | Bacteria | 1159 |
| 120 | Ga0400485_19972 | 3300038735 | Bacteria | 1540 |
| 121 | Ga0400485_20719 | 3300038735 | Bacteria | 18353 |
| 122 | Ga0400488_01707 | 3300038741 | Bacteria | 1832 |
| 123 | Ga0400488_19228 | 3300038741 | Bacteria | 5842 |
| 124 | Ga0400488_26699 | 3300038741 | Bacteria | 3940 |
| 125 | Ga0400488_53805 | 3300038741 | Bacteria | 13195 |
| 126 | Ga0400488_54869 | 3300038741 | Bacteria | 10513 |
| 127 | Ga0400488_61089 | 3300038741 | Bacteria | 2660 |
| 128 | Ga0400486_02119 | 3300038742 | Bacteria | 14138 |
| 129 | Ga0400486_22632 | 3300038742 | Bacteria | 22982 |
| 130 | Ga0400486_24271 | 3300038742 | Bacteria | 19379 |
| 131 | Ga0400483_000434 | 3300039062 | Bacteria | 7986 |
| 132 | Ga0400483_010485 | 3300039062 | Bacteria | 6089 |
| 133 | Ga0400483_014107 | 3300039062 | Bacteria | 2963 |
| 134 | Ga0400483_016696 | 3300039062 | Bacteria | 5040 |
| 135 | Ga0400483_019253 | 3300039062 | Unclassified | 2718 |
| 136 | Ga0400483_027958 | 3300039062 | Bacteria | 1461 |
| 137 | Ga0400483_043928 | 3300039062 | Unclassified | 1824 |
| 138 | Ga0400483_053399 | 3300039062 | Bacteria | 1098 |
| 139 | Ga0400483_100156 | 3300039062 | Bacteria | 37225 |
| 140 | Ga0400483_150363 | 3300039062 | Bacteria | 18914 |
| 141 | Ga0400483_231318 | 3300039062 | Bacteria | 16589 |
| 142 | Ga0400483_250011 | 3300039062 | Bacteria | 6692 |
| 143 | Ga0400483_260905 | 3300039062 | Bacteria | 2627 |
| 144 | Ga0400489_10025 | 3300039093 | Bacteria | 14564 |
| 145 | Ga0400489_19613 | 3300039093 | Bacteria | 33135 |
| 146 | Ga0400489_45280 | 3300039093 | Bacteria | 43768 |
| 147 | Ga0400489_69003 | 3300039093 | Bacteria | 9231 |
| 148 | Ga0400489_73905 | 3300039093 | Bacteria | 1995 |
| 149 | Ga0400489_84412 | 3300039093 | Bacteria | 1104 |
| 150 | Ga0400487_44020 | 3300039110 | Bacteria | 1746 |
| 151 | Ga0400487_49065 | 3300039110 | Bacteria | 6019 |
| 152 | Ga0400487_60765 | 3300039110 | Bacteria | 2249 |
| 153 | Ga0451577_0008895 | 3300042876 | Bacteria | 9720 |
| 154 | Ga0451577_0516220 | 3300042876 | Bacteria | 1085 |
| 155 | Ga0453683_0388431 | 3300044673 | Bacteria | 899 |
| 156 | Ga0453684_0007160 | 3300044712 | Bacteria | 20755 |
| 157 | Ga0453684_0009585 | 3300044712 | Bacteria | 16895 |
| 158 | Ga0453684_0037725 | 3300044712 | Bacteria | 6627 |
| 159 | Ga0453684_0064190 | 3300044712 | Bacteria | 4692 |
| 160 | Ga0453684_0441018 | 3300044712 | Bacteria | 1451 |
| 161 | Ga0453684_1099999 | 3300044712 | Bacteria | 840 |
| 162 | 2740992454 | 2740891818 | Bacteria | 6711283 |
| 163 | Ga0316574_0081935 | |||
| 164 | Ga0316575_10000780 | |||
| 165 | Ga0316575_10000864 | |||
| 166 | Ga0316575_10003526 | |||
| 167 | Ga0316575_10006608 | |||
| 168 | Ga0316575_10025158 | |||
| 169 | Ga0316575_10105079 | |||
| 170 | Ga0316575_10136826 | |||
| 171 | Ga0316575_10269810 | |||
| 172 | Ga0316579_10004284 | |||
| 173 | Ga0316579_10007446 | |||
| 174 | Ga0316579_10008122 | |||
| 175 | Ga0316579_10031325 | |||
| 176 | Ga0316579_10062537 | |||
| 177 | Ga0316579_10098390 | |||
| 178 | Ga0316579_10112381 | |||
| 179 | Ga0316579_10122754 | |||
| 180 | Ga0316579_10162271 | |||
| 181 | Ga0316576_10000928 | |||
| 182 | Ga0316576_10003702 | |||
| 183 | Ga0316576_10004533 | |||
| 184 | Ga0316576_10025873 | |||
| 185 | Ga0316576_10028902 | |||
| 186 | Ga0316576_10032008 | |||
| 187 | Ga0316576_10041588 | |||
| 188 | Ga0316576_10061388 | |||
| 189 | Ga0316576_10069020 | |||
| 190 | Ga0316576_10111300 | |||
| 191 | Ga0316576_10121733 | |||
| 192 | Ga0316576_10166823 | |||
| 193 | Ga0316576_10267491 | |||
| 194 | Ga0316576_10323112 | |||
| 195 | Ga0316578_10008233 | |||
| 196 | Ga0316578_10019908 | |||
| 197 | Ga0316578_10019962 | |||
| 198 | Ga0316578_10085791 | |||
| 199 | Ga0316578_10125163 | |||
| 200 | Ga0316578_10175797 | |||
| 201 | Ga0316577_10000520 | |||
| 202 | Ga0316577_10011946 | |||
| 203 | Ga0316577_10060240 | |||
| 204 | Ga0316577_10151213 | |||
| 205 | Ga0316577_10394309 | |||
| 206 | Ga0316583_10000188 | |||
| 207 | Ga0316583_10000898 | |||
| 208 | Ga0316583_10001255 | |||
| 209 | Ga0316583_10007982 | |||
| 210 | Ga0316583_10022650 | |||
| 211 | Ga0316583_10026112 | |||
| 212 | Ga0316583_10165256 | |||
| 213 | Ga0316583_10185694 | |||
| 214 | Ga0316585_10002620 | |||
| 215 | Ga0316585_10005420 | |||
| 216 | Ga0316585_10010006 | |||
| 217 | Ga0316585_10017358 | |||
| 218 | Ga0316585_10018394 | |||
| 219 | Ga0316585_10042214 | |||
| 220 | Ga0316585_10061497 | |||
| 221 | Ga0316585_10084310 | |||
| 222 | Ga0316585_10156225 | |||
| 223 | Ga0316580_10000854 | |||
| 224 | Ga0316580_10001729 | |||
| 225 | Ga0316580_10033096 | |||
| 226 | Ga0316580_10064093 | |||
| 227 | Ga0316574_0000019 | |||
| 228 | Ga0316574_0003420 | |||
| 229 | Ga0316574_0004576 | |||
| 230 | Ga0316574_0006747 | |||
| 231 | Ga0316574_0044430 | |||
| 232 | Ga0316574_0060770 | |||
| 233 | Ga0316574_0082598 | |||
| 234 | Ga0316574_0134373 | |||
| 235 | Ga0316574_0299028 | |||
| 236 | Ga0316574_0413261 | |||
| 237 | Ga0316582_0007344 | |||
| 238 | Ga0316582_0027167 | |||
| 239 | Ga0316582_0067440 | |||
| 240 | Ga0316582_0078210 | |||
| 241 | Ga0316582_0085639 | |||
| 242 | Ga0316582_0088901 | |||
| 243 | Ga0316582_0108130 | |||
| 244 | Ga0316582_0154740 | |||
| 245 | Ga0316582_0170807 | |||
| 246 | Ga0316582_0214529 | |||
| 247 | Ga0316582_0269807 | |||
| 248 | Ga0316582_0320532 | |||
| 249 | Ga0316584_0000241 | |||
| 250 | Ga0316584_0000858 | |||
| 251 | Ga0316584_0005779 | |||
| 252 | Ga0316584_0014345 | |||
| 253 | Ga0316584_0021387 | |||
| 254 | Ga0316584_0034165 | |||
| 255 | Ga0316584_0085531 | |||
| 256 | Ga0316584_0099820 | |||
| 257 | Ga0316584_0100611 | |||
| 258 | Ga0316584_0104549 | |||
| 259 | Ga0316584_0114074 | |||
| 260 | Ga0316584_0152683 | |||
| 261 | Ga0316584_0182307 | |||
| 262 | Ga0316584_0225965 | |||
| 263 | Ga0316584_0257568 | |||
| 264 | Ga0316584_0499441 | |||
| 265 | Ga0316584_0656398 | |||
| 266 | Ga0316584_0698279 | |||
| 267 | Ga0316581_0004849 | |||
| 268 | Ga0316581_0030471 | |||
| 269 | Ga0316581_0052019 | |||
| 270 | Ga0316581_0089448 | |||
| 271 | Ga0400484_02496 | |||
| 272 | Ga0400484_05847 | |||
| 273 | Ga0400484_27748 | |||
| 274 | Ga0400484_28725 | |||
| 275 | Ga0400484_39203 | |||
| 276 | Ga0400490_22704 | |||
| 277 | Ga0400490_55438 | |||
| 278 | Ga0400491_04737 | |||
| 279 | Ga0400491_10952 | |||
| 280 | Ga0400485_01986 | |||
| 281 | Ga0400485_16211 | |||
| 282 | Ga0400485_19972 | |||
| 283 | Ga0400485_20719 | |||
| 284 | Ga0400488_01707 | |||
| 285 | Ga0400488_19228 | |||
| 286 | Ga0400488_26699 | |||
| 287 | Ga0400488_53805 | |||
| 288 | Ga0400488_54869 | |||
| 289 | Ga0400488_61089 | |||
| 290 | Ga0400486_02119 | |||
| 291 | Ga0400486_22632 | |||
| 292 | Ga0400486_24271 | |||
| 293 | Ga0400483_000434 | |||
| 294 | Ga0400483_010485 | |||
| 295 | Ga0400483_014107 | |||
| 296 | Ga0400483_016696 | |||
| 297 | Ga0400483_019253 | |||
| 298 | Ga0400483_027958 | |||
| 299 | Ga0400483_043928 | |||
| 300 | Ga0400483_053399 | |||
| 301 | Ga0400483_100156 | |||
| 302 | Ga0400483_150363 | |||
| 303 | Ga0400483_231318 | |||
| 304 | Ga0400483_250011 | |||
| 305 | Ga0400483_260905 | |||
| 306 | Ga0400489_10025 | |||
| 307 | Ga0400489_19613 | |||
| 308 | Ga0400489_45280 | |||
| 309 | Ga0400489_69003 | |||
| 310 | Ga0400489_73905 | |||
| 311 | Ga0400489_84412 | |||
| 312 | Ga0400487_44020 | |||
| 313 | Ga0400487_49065 | |||
| 314 | Ga0400487_60765 | |||
| 315 | Ga0451577_0008895 | |||
| 316 | Ga0451577_0516220 | |||
| 317 | Ga0453683_0388431 | |||
| 318 | Ga0453684_0007160 | |||
| 319 | Ga0453684_0009585 | |||
| 320 | Ga0453684_0037725 | |||
| 321 | Ga0453684_0064190 | |||
| 322 | Ga0453684_0441018 | |||
| 323 | Ga0453684_1099999 | |||
| 324 | 2740992454 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4q25-assembly1.cif.gz_B | crystal structure of phou from pseudomonas aeruginosa | 0.9512 | 5 | 211 |
| 1sum-assembly1.cif.gz_B | crystal structure of a hypothetical protein at 2.0 a resolution | 0.9449 | 5 | 212 |
| 1t72-assembly1.cif.gz_A | crystal structure of phosphate transport system protein phou from aquifex aeolicus | 0.9405 | 4 | 211 |
| 4q25-assembly1.cif.gz_B | crystal structure of phou from pseudomonas aeruginosa | 0.9379 | 5 | 211 |
| 1xwm-assembly1.cif.gz_A-2 | the crystal structure of phou (phosphate uptake regulator), structural genomics | 0.9145 | 5 | 212 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4q25A02 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 | 0.9762 | 121 | 211 | 1.20.58.220 |
| af_P0A9K7_1_117_1.20.58.220 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 | 0.9709 | 2 | 104 | 1.20.58.220 |
| 1t8bB02 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 | 0.9638 | 121 | 210 | 1.20.58.220 |
| 4q25B02 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 | 0.9579 | 119 | 211 | 1.20.58.220 |
| af_Q58415_114_232_1.20.58.220 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 | 0.9554 | 121 | 214 | 1.20.58.220 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2G9ZZN8-F1-model_v4 | Phosphate-specific transport system accessory protein PhoU | 0.983 | 1 | 218 |
GO:0005737
GO:0006817 GO:0030643 GO:0045936 |
| AF-A0A1F6GDQ0-F1-model_v4 | Phosphate-specific transport system accessory protein PhoU | 0.9816 | 1 | 215 |
GO:0005737
GO:0006817 GO:0030643 GO:0045936 |
| AF-A0A7W0IXG0-F1-model_v4 | Phosphate-specific transport system accessory protein PhoU | 0.9815 | 1 | 218 |
GO:0005737
GO:0006817 GO:0030643 GO:0045936 |
| AF-A0A849DUX5-F1-model_v4 | Phosphate-specific transport system accessory protein PhoU | 0.9809 | 1 | 217 |
GO:0005737
GO:0006817 GO:0030643 GO:0045936 |
| AF-A0A7V5P1V6-F1-model_v4 | Phosphate signaling complex protein PhoU | 0.9803 | 1 | 215 |
GO:0030643
GO:0045936 |