F256764

General Info

Members Datasets Scaffolds Average Seq Length
170 134 340 112

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10820309|Ga0157369_108203092
Length 133
Sequence MVGKAISLKAAATRQLKLNLNTNMARYCLALDLKDDPQLIAEYEKYHESIWPEIRESIVAGGITDMEIYRCFNRLFMIMETDDATFSFDKKGAADAANPKVQEWEELMWKYQQALPGAKPDEKWVLMNKIFNL

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
63 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
102 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
113 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
114 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
115 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
116 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
119 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
120 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
121 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
122 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
126 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
127 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
128 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
129 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
134 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.35
Nodule 0
Rhizoplane 0
Rhizosphere 96.47
Stem 0
Stem Tuber 0
Unclassified 15.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10820309 3300013105 Bacteria 955
2 JGI24737J22298_10008003 3300001990 Bacteria 3552
3 JGI24735J21928_10066451 3300002067 Bacteria 1034
4 Ga0065714_10068795 3300005288 Bacteria 4533
5 Ga0065707_10344771 3300005295 Bacteria 928
6 Ga0070658_10284787 3300005327 Bacteria 1407
7 Ga0070666_10169558 3300005335 Bacteria 1528
8 Ga0070680_100788285 3300005336 Bacteria 819
9 Ga0070660_100001082 3300005339 Bacteria 18309
10 Ga0070660_100811346 3300005339 Bacteria 787
11 Ga0070687_100190691 3300005343 Bacteria 1235
12 Ga0070669_101096779 3300005353 Bacteria 685
13 Ga0070669_101548653 3300005353 Bacteria 577
14 Ga0070675_100012847 3300005354 Bacteria 6571
15 Ga0070675_100549067 3300005354 Bacteria 1045
16 Ga0070675_101232593 3300005354 Bacteria 689
17 Ga0070671_100074633 3300005355 Bacteria 2833
18 Ga0070674_100101832 3300005356 Bacteria 2094
19 Ga0070674_100776050 3300005356 Unclassified 826
20 Ga0070673_100149398 3300005364 Bacteria 1978
21 Ga0070673_101121969 3300005364 Bacteria 735
22 Ga0070659_100033648 3300005366 Bacteria 3982
23 Ga0070659_100046469 3300005366 Bacteria 3403
24 Ga0070659_100307197 3300005366 Bacteria 1324
25 Ga0070713_101611593 3300005436 Bacteria 630
26 Ga0070700_100576144 3300005441 Bacteria 878
27 Ga0070663_100415075 3300005455 Bacteria 1103
28 Ga0070662_100385753 3300005457 Bacteria 1154
29 Ga0070681_10278422 3300005458 Bacteria 1584
30 Ga0068867_100037821 3300005459 Bacteria 3510
31 Ga0070685_11504693 3300005466 Unclassified 519
32 Ga0070706_100630637 3300005467 Bacteria 995
33 Ga0070699_101234166 3300005518 Unclassified 686
34 Ga0070679_101020029 3300005530 Bacteria 772
35 Ga0070684_100092901 3300005535 Bacteria 2685
36 Ga0070684_100257702 3300005535 Unclassified 1595
37 Ga0068853_101358451 3300005539 Bacteria 687
38 Ga0070672_100108440 3300005543 Bacteria 2260
39 Ga0070686_100240232 3300005544 Bacteria 1318
40 Ga0070665_102178698 3300005548 Unclassified 558
41 Ga0070664_100441251 3300005564 Bacteria 1194
42 Ga0068857_100007884 3300005577 Bacteria 9186
43 Ga0068857_101592786 3300005577 Bacteria 637
44 Ga0070702_100011497 3300005615 Bacteria 4404
45 Ga0068852_101196164 3300005616 Bacteria 781
46 Ga0068852_102362120 3300005616 Unclassified 552
47 Ga0068859_101584620 3300005617 Unclassified 723
48 Ga0068864_100034855 3300005618 Bacteria 4283
49 Ga0068866_10358938 3300005718 Unclassified 928
50 Ga0068870_10288799 3300005840 Bacteria 1031
51 Ga0068863_101176169 3300005841 Bacteria 772
52 Ga0068863_101650042 3300005841 Bacteria 650
53 Ga0068860_100975071 3300005843 Unclassified 865
54 Ga0070717_10835449 3300006028 Bacteria 838
55 Ga0070716_100381652 3300006173 Bacteria 1007
56 Ga0075428_100008501 3300006844 Bacteria 11388
57 Ga0075430_100071931 3300006846 Bacteria 2901
58 Ga0075431_100190221 3300006847 Bacteria 2103
59 Ga0075429_100000564 3300006880 Bacteria 28419
60 Ga0097620_101584902 3300006931 Unclassified 723
61 Ga0111539_10286638 3300009094 Bacteria 1916
62 Ga0105245_11790401 3300009098 Unclassified 667
63 Ga0105248_10508835 3300009177 Bacteria 1358
64 Ga0157373_10002161 3300013100 Bacteria 14880
65 Ga0157373_10004836 3300013100 Bacteria 10136
66 Ga0157373_10034215 3300013100 Bacteria 3649
67 Ga0157373_10874775 3300013100 Bacteria 666
68 Ga0157373_10908023 3300013100 Unclassified 654
69 Ga0157371_10003341 3300013102 Bacteria 14628
70 Ga0157371_10951959 3300013102 Unclassified 653
71 Ga0157370_10156776 3300013104 Bacteria 2118
72 Ga0157369_10129882 3300013105 Bacteria 2670
73 Ga0157378_10021498 3300013297 Bacteria 5674
74 Ga0163162_10006780 3300013306 Bacteria 11112
75 Ga0157372_10016663 3300013307 Bacteria 7888
76 Ga0157375_11049114 3300013308 Unclassified 953
77 Ga0157380_10002211 3300014326 Bacteria 13085
78 Ga0157380_10130521 3300014326 Bacteria 2143
79 Ga0182008_10008615 3300014497 Bacteria 5555
80 Ga0157379_11144482 3300014968 Unclassified 747
81 Ga0182007_10002394 3300015262 Bacteria 9379
82 Ga0182007_10048045 3300015262 Bacteria 1410
83 Ga0183373_1010 3300015682 Bacteria 196982
84 Ga0163161_10001712 3300017792 Bacteria 16070
85 Ga0163161_11027203 3300017792 Bacteria 705
86 Ga0207427_124778 3300025231 Bacteria 525
87 Ga0209233_1011832 3300025261 Bacteria 2559
88 Ga0207647_10000249 3300025904 Bacteria 44055
89 Ga0207685_10587536 3300025905 Bacteria 596
90 Ga0207645_10414211 3300025907 Unclassified 907
91 Ga0207705_10486368 3300025909 Bacteria 958
92 Ga0207684_10344219 3300025910 Bacteria 1284
93 Ga0207707_10494802 3300025912 Bacteria 1043
94 Ga0207660_10910877 3300025917 Bacteria 717
95 Ga0207662_10047702 3300025918 Bacteria 2537
96 Ga0207657_10001634 3300025919 Bacteria 24147
97 Ga0207657_10925575 3300025919 Bacteria 671
98 Ga0207681_10809049 3300025923 Unclassified 783
99 Ga0207650_10157280 3300025925 Bacteria 1798
100 Ga0207659_10033357 3300025926 Bacteria 3543
101 Ga0207659_10071221 3300025926 Unclassified 2538
102 Ga0207700_11640221 3300025928 Bacteria 568
103 Ga0207690_10027441 3300025932 Bacteria 3598
104 Ga0207690_10079449 3300025932 Bacteria 2286
105 Ga0207706_10033675 3300025933 Bacteria 4559
106 Ga0207670_10638738 3300025936 Bacteria 877
107 Ga0207704_10215318 3300025938 Unclassified 1417
108 Ga0207665_10142228 3300025939 Bacteria 1712
109 Ga0207711_11428961 3300025941 Unclassified 634
110 Ga0207661_11233364 3300025944 Bacteria 688
111 Ga0207679_10129201 3300025945 Bacteria 2024
112 Ga0207679_10171339 3300025945 Bacteria 1787
113 Ga0207667_11417974 3300025949 Bacteria 668
114 Ga0207651_10867689 3300025960 Bacteria 803
115 Ga0207677_11804938 3300026023 Unclassified 568
116 Ga0207703_10430590 3300026035 Bacteria 1229
117 Ga0207639_10068178 3300026041 Bacteria 2771
118 Ga0207678_10939417 3300026067 Bacteria 765
119 Ga0207708_10742631 3300026075 Bacteria 842
120 Ga0207641_11389678 3300026088 Bacteria 703
121 Ga0207648_10204296 3300026089 Bacteria 1753
122 Ga0207676_10026395 3300026095 Bacteria 4321
123 Ga0207674_10025715 3300026116 Bacteria 6268
124 Ga0207674_10321738 3300026116 Bacteria 1496
125 Ga0207698_11719889 3300026142 Bacteria 643
126 Ga0207428_10243383 3300027907 Bacteria 1343
127 Ga0307515_10414309 3300028794 Bacteria 969
128 Ga0307515_10522423 3300028794 Unclassified 796
129 Ga0316181_1190315 3300030744 Bacteria 3579
130 Ga0307405_11577403 3300031731 Bacteria 579
131 Ga0307412_10134989 3300031911 Unclassified 1799
132 Ga0307412_11617135 3300031911 Bacteria 592
133 Ga0307416_101636417 3300032002 Bacteria 749
134 Ga0307414_10002029 3300032004 Bacteria 10513
135 Ga0307414_10014405 3300032004 Bacteria 4740
136 Ga0307414_10076563 3300032004 Bacteria 2431
137 Ga0307414_10191498 3300032004 Bacteria 1655
138 Ga0307414_10269727 3300032004 Bacteria 1425
139 Ga0307411_10081818 3300032005 Bacteria 2225
140 Ga0307411_10310538 3300032005 Bacteria 1269
141 Ga0307415_101072818 3300032126 Bacteria 753
142 Ga0373955_0164612 3300035172 Bacteria 1311
143 Ga0373955_0783410 3300035172 Unclassified 586
144 Ga0395900_0507724 3300037418 Bacteria 1155
145 Ga0395900_1426293 3300037418 Bacteria 605
146 Ga0395905_0255951 3300037471 Bacteria 1635
147 Ga0450896_059064 3300042133 Bacteria 622
148 Ga0439435_0046277 3300042436 Bacteria 1232
149 Ga0451577_0229152 3300042876 Unclassified 1680
150 Ga0466970_0809331 3300044765 Bacteria 549
151 Ga0466960_0089188 3300044901 Bacteria 1569
152 Ga0466967_1094979 3300045976 Bacteria 794
153 Ga0495638_0019620 3300046460 Bacteria 4472
154 Ga0495609_0012124 3300046538 Bacteria 4092
155 Ga0495672_0018865 3300047320 Bacteria 4569
156 Ga0495686_0130435 3300047472 Bacteria 1491
157 Ga0501034_0006855 3300049571 Bacteria 12189
158 Ga0501038_0910209 3300049574 Bacteria 649
159 Ga0501070_0820790 3300049586 Bacteria 729
160 Ga0501217_131045 3300049661 Bacteria 735
161 Ga0501233_232529 3300049668 Unclassified 548
162 Ga0501235_056989 3300049669 Bacteria 912
163 Ga0501235_071994 3300049669 Bacteria 819
164 Ga0501219_000083 3300049703 Bacteria 16095
165 Ga0501035_0031340 3300049822 Bacteria 4843
166 Ga0501044_0839004 3300049823 Bacteria 796
167 Ga0501284_00119 3300050005 Bacteria 13267
168 nmdc:mga08y16_113937_c1 3300050511 Bacteria 2815
169 Ga0500577_0365952 3300053142 Bacteria 631
170 Ga0500611_000008 3300053727 Bacteria 198346
171 Ga0157369_10820309
172 JGI24737J22298_10008003
173 JGI24735J21928_10066451
174 Ga0065714_10068795
175 Ga0065707_10344771
176 Ga0070658_10284787
177 Ga0070666_10169558
178 Ga0070680_100788285
179 Ga0070660_100001082
180 Ga0070660_100811346
181 Ga0070687_100190691
182 Ga0070669_101096779
183 Ga0070669_101548653
184 Ga0070675_100012847
185 Ga0070675_100549067
186 Ga0070675_101232593
187 Ga0070671_100074633
188 Ga0070674_100101832
189 Ga0070674_100776050
190 Ga0070673_100149398
191 Ga0070673_101121969
192 Ga0070659_100033648
193 Ga0070659_100046469
194 Ga0070659_100307197
195 Ga0070713_101611593
196 Ga0070700_100576144
197 Ga0070663_100415075
198 Ga0070662_100385753
199 Ga0070681_10278422
200 Ga0068867_100037821
201 Ga0070685_11504693
202 Ga0070706_100630637
203 Ga0070699_101234166
204 Ga0070679_101020029
205 Ga0070684_100092901
206 Ga0070684_100257702
207 Ga0068853_101358451
208 Ga0070672_100108440
209 Ga0070686_100240232
210 Ga0070665_102178698
211 Ga0070664_100441251
212 Ga0068857_100007884
213 Ga0068857_101592786
214 Ga0070702_100011497
215 Ga0068852_101196164
216 Ga0068852_102362120
217 Ga0068859_101584620
218 Ga0068864_100034855
219 Ga0068866_10358938
220 Ga0068870_10288799
221 Ga0068863_101176169
222 Ga0068863_101650042
223 Ga0068860_100975071
224 Ga0070717_10835449
225 Ga0070716_100381652
226 Ga0075428_100008501
227 Ga0075430_100071931
228 Ga0075431_100190221
229 Ga0075429_100000564
230 Ga0097620_101584902
231 Ga0111539_10286638
232 Ga0105245_11790401
233 Ga0105248_10508835
234 Ga0157373_10002161
235 Ga0157373_10004836
236 Ga0157373_10034215
237 Ga0157373_10874775
238 Ga0157373_10908023
239 Ga0157371_10003341
240 Ga0157371_10951959
241 Ga0157370_10156776
242 Ga0157369_10129882
243 Ga0157378_10021498
244 Ga0163162_10006780
245 Ga0157372_10016663
246 Ga0157375_11049114
247 Ga0157380_10002211
248 Ga0157380_10130521
249 Ga0182008_10008615
250 Ga0157379_11144482
251 Ga0182007_10002394
252 Ga0182007_10048045
253 Ga0183373_1010
254 Ga0163161_10001712
255 Ga0163161_11027203
256 Ga0207427_124778
257 Ga0209233_1011832
258 Ga0207647_10000249
259 Ga0207685_10587536
260 Ga0207645_10414211
261 Ga0207705_10486368
262 Ga0207684_10344219
263 Ga0207707_10494802
264 Ga0207660_10910877
265 Ga0207662_10047702
266 Ga0207657_10001634
267 Ga0207657_10925575
268 Ga0207681_10809049
269 Ga0207650_10157280
270 Ga0207659_10033357
271 Ga0207659_10071221
272 Ga0207700_11640221
273 Ga0207690_10027441
274 Ga0207690_10079449
275 Ga0207706_10033675
276 Ga0207670_10638738
277 Ga0207704_10215318
278 Ga0207665_10142228
279 Ga0207711_11428961
280 Ga0207661_11233364
281 Ga0207679_10129201
282 Ga0207679_10171339
283 Ga0207667_11417974
284 Ga0207651_10867689
285 Ga0207677_11804938
286 Ga0207703_10430590
287 Ga0207639_10068178
288 Ga0207678_10939417
289 Ga0207708_10742631
290 Ga0207641_11389678
291 Ga0207648_10204296
292 Ga0207676_10026395
293 Ga0207674_10025715
294 Ga0207674_10321738
295 Ga0207698_11719889
296 Ga0207428_10243383
297 Ga0307515_10414309
298 Ga0307515_10522423
299 Ga0316181_1190315
300 Ga0307405_11577403
301 Ga0307412_10134989
302 Ga0307412_11617135
303 Ga0307416_101636417
304 Ga0307414_10002029
305 Ga0307414_10014405
306 Ga0307414_10076563
307 Ga0307414_10191498
308 Ga0307414_10269727
309 Ga0307411_10081818
310 Ga0307411_10310538
311 Ga0307415_101072818
312 Ga0373955_0164612
313 Ga0373955_0783410
314 Ga0395900_0507724
315 Ga0395900_1426293
316 Ga0395905_0255951
317 Ga0450896_059064
318 Ga0439435_0046277
319 Ga0451577_0229152
320 Ga0466970_0809331
321 Ga0466960_0089188
322 Ga0466967_1094979
323 Ga0495638_0019620
324 Ga0495609_0012124
325 Ga0495672_0018865
326 Ga0495686_0130435
327 Ga0501034_0006855
328 Ga0501038_0910209
329 Ga0501070_0820790
330 Ga0501217_131045
331 Ga0501233_232529
332 Ga0501235_056989
333 Ga0501235_071994
334 Ga0501219_000083
335 Ga0501035_0031340
336 Ga0501044_0839004
337 Ga0501284_00119
338 nmdc:mga08y16_113937_c1
339 Ga0500577_0365952
340 Ga0500611_000008

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05336

rhaM

L-rhamnose mutarotase

26

133

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7byw-assembly1.cif.gz_B crystal structure of acidovorax avenae l-fucose mutarotase (l-fucose-bound form) 0.894 2 110
7byw-assembly1.cif.gz_B crystal structure of acidovorax avenae l-fucose mutarotase (l-fucose-bound form) 0.8786 2 110
5ds1-assembly1.cif.gz_A-2 core domain of the class ii small heat-shock protein hsp 17.7 from pisum sativum 0.8116 40 57
6hhn-assembly1.cif.gz_A-2 crystal structure of l-rhamnose mutarotase fa22100 from formosa agariphila 0.7994 1 110
1x8d-assembly2.cif.gz_D crystal structure of e. coli yiil protein containing l-rhamnose 0.7896 1 110
ID Description Score Start End Superfamily
af_Q556R9_3_105_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8649 2 98 3.30.70.100
1x8dD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8126 1 93 3.30.70.100
af_Q556R9_3_105_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8105 2 98 3.30.70.100
af_Q54E44_538_670_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7443 40 60 2.60.40.790
1x8dD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7371 1 93 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A2W0AJ85-F1-model_v4 L-fucose mutarotase 0.9961 2 110 GO:0016857
AF-A0A258F9D0-F1-model_v4 L-fucose mutarotase 0.996 2 110 GO:0016857
AF-A0A2V9ZDP5-F1-model_v4 L-fucose mutarotase 0.9941 2 110 GO:0016857
AF-A0A286F4J5-F1-model_v4 L-rhamnose mutarotase 0.9931 2 110 GO:0016857
AF-A0A1M7I8B2-F1-model_v4 L-rhamnose mutarotase 0.9924 1 110 GO:0016857

Map