F256533

General Info

Members Datasets Scaffolds Average Seq Length
170 130 340 274

Family's Representative Sequence

Representative Sequence 3300006237|Ga0097621_100184182|Ga0097621_1001841822
Length 263
Sequence MHSGFVSARFPRAAKYHADWLRASASGGANSLWLTEWLAEALGLEPGMRVLDLGCGRAASSIFLHREFGVQVWAVDLWCDPGENQQRIDDAQVQGDVFPLRADARALPFEADFFDAVVSIDAYVYFGTDDMYLNYLAGFLKPEGLIGIAGAGLMHEFDAYDEVPEHLRAWWTPGHACLHSAQWWRRHWERSGLVDVAVADTLADGWQYWLDWQRAITPDNAIEIDALEDDGGSNLGYVRVVAGRRGDVMPDPNYVRQPLLAER

Samples

Sample ID Description Type Environment
1 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
81 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
82 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
87 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
88 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
90 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
91 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
97 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
100 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
101 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
102 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
103 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
104 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
105 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
106 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
112 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
113 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
114 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
115 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
116 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
117 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
118 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
119 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
120 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
121 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
122 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
123 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
124 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
125 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
126 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
127 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
128 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
129 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
130 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.82
Metatranscriptomes 0.59
Isolates 0.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.76
Nodule 0
Rhizoplane 1.18
Rhizosphere 95.29
Stem 0
Stem Tuber 0
Unclassified 24.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0097621_100184182 3300006237 Bacteria 1806
2 Ga0070670_100162950 3300005331 Bacteria 1933
3 Ga0068869_100193192 3300005334 Unclassified 1601
4 Ga0068868_100154585 3300005338 Unclassified 1891
5 Ga0068868_100383101 3300005338 Bacteria 1210
6 Ga0070689_100048700 3300005340 Unclassified 3269
7 Ga0070675_100000151 3300005354 Bacteria 41859
8 Ga0070671_100011188 3300005355 Bacteria 7207
9 Ga0070674_100126240 3300005356 Unclassified 1901
10 Ga0070673_100008278 3300005364 Bacteria 6908
11 Ga0070688_100074395 3300005365 Bacteria 2182
12 Ga0070667_100006397 3300005367 Bacteria 9790
13 Ga0070709_10001416 3300005434 Bacteria 13003
14 Ga0070714_100378382 3300005435 Unclassified 1334
15 Ga0070713_100227854 3300005436 Bacteria 1693
16 Ga0070710_10032501 3300005437 Bacteria 2827
17 Ga0068867_100102162 3300005459 Bacteria 2191
18 Ga0068867_100251300 3300005459 Bacteria 1438
19 Ga0070685_10085427 3300005466 Unclassified 1900
20 Ga0070698_100505192 3300005471 Unclassified 1147
21 Ga0070699_100002633 3300005518 Bacteria 16034
22 Ga0070664_100047590 3300005564 Bacteria 3623
23 Ga0068857_100071271 3300005577 Bacteria 3096
24 Ga0068859_100013518 3300005617 Bacteria 8187
25 Ga0068859_100725618 3300005617 Unclassified 1084
26 Ga0068864_100088285 3300005618 Unclassified 2731
27 Ga0068863_100004736 3300005841 Archaea 13406
28 Ga0068863_100030243 3300005841 Bacteria 5173
29 Ga0068863_100089860 3300005841 Unclassified 2912
30 Ga0068863_100244566 3300005841 Bacteria 1732
31 Ga0068858_100099079 3300005842 Unclassified 2717
32 Ga0068858_100731426 3300005842 Unclassified 963
33 Ga0068860_100035171 3300005843 Unclassified 4806
34 Ga0068860_100363345 3300005843 Unclassified 1426
35 Ga0068862_100552945 3300005844 Unclassified 1099
36 Ga0081539_10018058 3300005985 Unclassified 4914
37 Ga0070717_10015712 3300006028 Bacteria 5852
38 Ga0075364_10052940 3300006051 Bacteria 2653
39 Ga0070716_100055039 3300006173 Bacteria 2275
40 Ga0070712_100000387 3300006175 Bacteria 25124
41 Ga0070712_100329756 3300006175 Bacteria 1243
42 Ga0097621_100031172 3300006237 Unclassified 4229
43 Ga0097621_100181315 3300006237 Bacteria 1820
44 Ga0068871_100103063 3300006358 Bacteria 2392
45 Ga0068871_100707829 3300006358 Bacteria 923
46 Ga0075431_100185810 3300006847 Bacteria 2131
47 Ga0075431_100235857 3300006847 Bacteria 1862
48 Ga0075434_100080401 3300006871 Bacteria 3256
49 Ga0075429_100318051 3300006880 Bacteria 1362
50 Ga0097620_100013515 3300006931 Bacteria 8187
51 Ga0097620_100725635 3300006931 Unclassified 1084
52 Ga0111539_10045867 3300009094 Bacteria 5230
53 Ga0111539_10343227 3300009094 Unclassified 1738
54 Ga0105245_10022491 3300009098 Bacteria 5534
55 Ga0105245_10813696 3300009098 Bacteria 973
56 Ga0114129_10323342 3300009147 Bacteria 2050
57 Ga0105242_10007004 3300009176 Bacteria 8706
58 Ga0105242_10220000 3300009176 Bacteria 1696
59 Ga0105237_10340980 3300009545 Bacteria 1503
60 Ga0105238_10005422 3300009551 Bacteria 12601
61 Ga0105249_10005525 3300009553 Bacteria 10920
62 Ga0105239_10143480 3300010375 Bacteria 2662
63 Ga0105246_10037664 3300011119 Bacteria 3246
64 Ga0157374_10168717 3300013296 Bacteria 2134
65 Ga0157375_10197925 3300013308 Bacteria 2165
66 Ga0163163_10236543 3300014325 Bacteria 1876
67 Ga0157376_10316453 3300014969 Bacteria 1482
68 Ga0157376_10374012 3300014969 Unclassified 1370
69 Ga0157376_10702101 3300014969 Bacteria 1017
70 Ga0207692_10045797 3300025898 Bacteria 2190
71 Ga0207688_10240648 3300025901 Bacteria 1094
72 Ga0207680_10055389 3300025903 Unclassified 2390
73 Ga0207699_10001422 3300025906 Bacteria 11349
74 Ga0207693_10000076 3300025915 Bacteria 88185
75 Ga0207646_10002294 3300025922 Bacteria 22720
76 Ga0207681_10457497 3300025923 Unclassified 1039
77 Ga0207694_10008088 3300025924 Bacteria 7948
78 Ga0207659_10043397 3300025926 Unclassified 3158
79 Ga0207687_10094566 3300025927 Unclassified 2187
80 Ga0207700_10006015 3300025928 Bacteria 7302
81 Ga0207700_10198877 3300025928 Bacteria 1688
82 Ga0207664_10336564 3300025929 Unclassified 1334
83 Ga0207686_10009905 3300025934 Bacteria 5180
84 Ga0207670_10030192 3300025936 Bacteria 3461
85 Ga0207670_10102512 3300025936 Unclassified 2046
86 Ga0207669_10046308 3300025937 Bacteria 2569
87 Ga0207665_10006815 3300025939 Bacteria 7569
88 Ga0207691_10004915 3300025940 Bacteria 12904
89 Ga0207691_10019039 3300025940 Bacteria 6501
90 Ga0207711_10010582 3300025941 Archaea 7668
91 Ga0207689_10021481 3300025942 Bacteria 5426
92 Ga0207689_10061004 3300025942 Bacteria 3101
93 Ga0207679_10081786 3300025945 Unclassified 2471
94 Ga0207651_10157379 3300025960 Bacteria 1777
95 Ga0207703_10042021 3300026035 Unclassified 3665
96 Ga0207703_10550776 3300026035 Bacteria 1087
97 Ga0207641_10014459 3300026088 Bacteria 6466
98 Ga0207641_10034809 3300026088 Bacteria 4192
99 Ga0207641_10054303 3300026088 Bacteria 3399
100 Ga0207641_10075983 3300026088 Unclassified 2902
101 Ga0207641_10110209 3300026088 Unclassified 2439
102 Ga0207676_10056761 3300026095 Unclassified 3080
103 Ga0207676_10221853 3300026095 Bacteria 1684
104 Ga0207683_10430157 3300026121 Bacteria 1216
105 Ga0207683_10438552 3300026121 Bacteria 1204
106 Ga0268264_10052891 3300028381 Bacteria 3387
107 Ga0268264_10602053 3300028381 Bacteria 1083
108 Ga0268264_10648496 3300028381 Unclassified 1045
109 Ga0265319_1020459 3300028563 Bacteria 2452
110 Ga0265338_10046087 3300028800 Bacteria 3999
111 Ga0265760_10023129 3300031090 Bacteria 1804
112 Ga0265320_10013673 3300031240 Bacteria 4655
113 Ga0265314_10106499 3300031711 Bacteria 1791
114 Ga0265342_10058691 3300031712 Bacteria 2274
115 Ga0307413_10028885 3300031824 Unclassified 3096
116 Ga0307410_10234661 3300031852 Bacteria 1418
117 Ga0307409_100231637 3300031995 Bacteria 1675
118 Ga0373926_0002401 3300035083 Bacteria 5934
119 Ga0373926_0061174 3300035083 Bacteria 1373
120 Ga0373943_0016195 3300035170 Bacteria 3397
121 Ga0373935_0007023 3300035692 Bacteria 6721
122 Ga0373927_0016680 3300035695 Bacteria 4845
123 Ga0373927_0033602 3300035695 Bacteria 3339
124 Ga0373947_0053515 3300035725 Unclassified 2434
125 Ga0373947_0080557 3300035725 Bacteria 2014
126 Ga0373925_0002055 3300037068 Bacteria 16590
127 Ga0395900_0127871 3300037418 Unclassified 2605
128 Ga0395898_0515261 3300037466 Unclassified 1137
129 Ga0436364_0048250 3300037853 Bacteria 26887
130 Ga0436365_1405051 3300039437 Unclassified 4497
131 Ga0436365_1530169 3300039437 Bacteria 1010
132 Ga0450896_000631 3300042133 Bacteria 3837
133 Ga0453684_0092243 3300044712 Bacteria 3735
134 Ga0451576_0026819 3300045051 Bacteria 6191
135 Ga0451576_0506578 3300045051 Bacteria 1268
136 Ga0495638_0018276 3300046460 Bacteria 4658
137 Ga0495653_0190075 3300046463 Bacteria 1402
138 Ga0495580_0086210 3300046472 Unclassified 2187
139 Ga0495662_0116557 3300046476 Bacteria 1310
140 Ga0495676_0226619 3300047321 Bacteria 1285
141 Ga0496109_0309834 3300048912 Bacteria 1489
142 Ga0496115_0133189 3300048918 Bacteria 2049
143 Ga0501033_0226758 3300049570 Bacteria 1328
144 Ga0501039_0040839 3300049575 Bacteria 3581
145 Ga0501040_0032511 3300049576 Bacteria 3530
146 Ga0501042_0081986 3300049578 Bacteria 2312
147 Ga0501046_0313258 3300049580 Bacteria 1144
148 Ga0501072_0387166 3300049588 Bacteria 1109
149 Ga0501075_0099063 3300049591 Bacteria 2213
150 Ga0501076_0441418 3300049592 Bacteria 1071
151 Ga0501077_0034347 3300049593 Bacteria 3228
152 Ga0501081_0074097 3300049743 Bacteria 2375
153 nmdc:mga05p37_114045_c1 3300050507 Bacteria 3322
154 nmdc:mga09592_312351_c1 3300050508 Bacteria 1362
155 nmdc:mga06r32_164180_c1 3300050510 Bacteria 2204
156 nmdc:mga08y16_254199_c1 3300050511 Bacteria 1815
157 nmdc:mga08y16_25665_c1 3300050511 Bacteria 4214
158 nmdc:mga0n895_109979_c1 3300050512 Bacteria 2771
159 nmdc:mga0n895_75958_c1 3300050512 Bacteria 3341
160 nmdc:mga0a205_83117_c1 3300050515 Unclassified 3093
161 nmdc:mga0a205_8436_c3 3300050515 Bacteria 5440
162 Ga0495619_0255985 3300053085 Unclassified 1213
163 Ga0500555_000128 3300053103 Bacteria 35985
164 Ga0500645_000272 3300053730 Bacteria 37020
165 Ga0501084_0346820 3300054114 Bacteria 1254
166 Ga0590071_002723 3300059421 Bacteria 4429
167 Ga0590075_016576 3300059424 Unclassified 1813
168 Ga0501082_0124427 3300060353 Bacteria 2236
169 Ga0530510_0021241 3300061734 Bacteria 4618
170 2889419512 2889415604 Bacteria 8048700
171 Ga0097621_100184182
172 Ga0070670_100162950
173 Ga0068869_100193192
174 Ga0068868_100154585
175 Ga0068868_100383101
176 Ga0070689_100048700
177 Ga0070675_100000151
178 Ga0070671_100011188
179 Ga0070674_100126240
180 Ga0070673_100008278
181 Ga0070688_100074395
182 Ga0070667_100006397
183 Ga0070709_10001416
184 Ga0070714_100378382
185 Ga0070713_100227854
186 Ga0070710_10032501
187 Ga0068867_100102162
188 Ga0068867_100251300
189 Ga0070685_10085427
190 Ga0070698_100505192
191 Ga0070699_100002633
192 Ga0070664_100047590
193 Ga0068857_100071271
194 Ga0068859_100013518
195 Ga0068859_100725618
196 Ga0068864_100088285
197 Ga0068863_100004736
198 Ga0068863_100030243
199 Ga0068863_100089860
200 Ga0068863_100244566
201 Ga0068858_100099079
202 Ga0068858_100731426
203 Ga0068860_100035171
204 Ga0068860_100363345
205 Ga0068862_100552945
206 Ga0081539_10018058
207 Ga0070717_10015712
208 Ga0075364_10052940
209 Ga0070716_100055039
210 Ga0070712_100000387
211 Ga0070712_100329756
212 Ga0097621_100031172
213 Ga0097621_100181315
214 Ga0068871_100103063
215 Ga0068871_100707829
216 Ga0075431_100185810
217 Ga0075431_100235857
218 Ga0075434_100080401
219 Ga0075429_100318051
220 Ga0097620_100013515
221 Ga0097620_100725635
222 Ga0111539_10045867
223 Ga0111539_10343227
224 Ga0105245_10022491
225 Ga0105245_10813696
226 Ga0114129_10323342
227 Ga0105242_10007004
228 Ga0105242_10220000
229 Ga0105237_10340980
230 Ga0105238_10005422
231 Ga0105249_10005525
232 Ga0105239_10143480
233 Ga0105246_10037664
234 Ga0157374_10168717
235 Ga0157375_10197925
236 Ga0163163_10236543
237 Ga0157376_10316453
238 Ga0157376_10374012
239 Ga0157376_10702101
240 Ga0207692_10045797
241 Ga0207688_10240648
242 Ga0207680_10055389
243 Ga0207699_10001422
244 Ga0207693_10000076
245 Ga0207646_10002294
246 Ga0207681_10457497
247 Ga0207694_10008088
248 Ga0207659_10043397
249 Ga0207687_10094566
250 Ga0207700_10006015
251 Ga0207700_10198877
252 Ga0207664_10336564
253 Ga0207686_10009905
254 Ga0207670_10030192
255 Ga0207670_10102512
256 Ga0207669_10046308
257 Ga0207665_10006815
258 Ga0207691_10004915
259 Ga0207691_10019039
260 Ga0207711_10010582
261 Ga0207689_10021481
262 Ga0207689_10061004
263 Ga0207679_10081786
264 Ga0207651_10157379
265 Ga0207703_10042021
266 Ga0207703_10550776
267 Ga0207641_10014459
268 Ga0207641_10034809
269 Ga0207641_10054303
270 Ga0207641_10075983
271 Ga0207641_10110209
272 Ga0207676_10056761
273 Ga0207676_10221853
274 Ga0207683_10430157
275 Ga0207683_10438552
276 Ga0268264_10052891
277 Ga0268264_10602053
278 Ga0268264_10648496
279 Ga0265319_1020459
280 Ga0265338_10046087
281 Ga0265760_10023129
282 Ga0265320_10013673
283 Ga0265314_10106499
284 Ga0265342_10058691
285 Ga0307413_10028885
286 Ga0307410_10234661
287 Ga0307409_100231637
288 Ga0373926_0002401
289 Ga0373926_0061174
290 Ga0373943_0016195
291 Ga0373935_0007023
292 Ga0373927_0016680
293 Ga0373927_0033602
294 Ga0373947_0053515
295 Ga0373947_0080557
296 Ga0373925_0002055
297 Ga0395900_0127871
298 Ga0395898_0515261
299 Ga0436364_0048250
300 Ga0436365_1405051
301 Ga0436365_1530169
302 Ga0450896_000631
303 Ga0453684_0092243
304 Ga0451576_0026819
305 Ga0451576_0506578
306 Ga0495638_0018276
307 Ga0495653_0190075
308 Ga0495580_0086210
309 Ga0495662_0116557
310 Ga0495676_0226619
311 Ga0496109_0309834
312 Ga0496115_0133189
313 Ga0501033_0226758
314 Ga0501039_0040839
315 Ga0501040_0032511
316 Ga0501042_0081986
317 Ga0501046_0313258
318 Ga0501072_0387166
319 Ga0501075_0099063
320 Ga0501076_0441418
321 Ga0501077_0034347
322 Ga0501081_0074097
323 nmdc:mga05p37_114045_c1
324 nmdc:mga09592_312351_c1
325 nmdc:mga06r32_164180_c1
326 nmdc:mga08y16_254199_c1
327 nmdc:mga08y16_25665_c1
328 nmdc:mga0n895_109979_c1
329 nmdc:mga0n895_75958_c1
330 nmdc:mga0a205_83117_c1
331 nmdc:mga0a205_8436_c3
332 Ga0495619_0255985
333 Ga0500555_000128
334 Ga0500645_000272
335 Ga0501084_0346820
336 Ga0590071_002723
337 Ga0590075_016576
338 Ga0501082_0124427
339 Ga0530510_0021241
340 2889419512

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13649

Methyltransf_25

Methyltransferase domain

50

144

0.91

PF08241

Methyltransf_11

Methyltransferase domain

51

148

0.88

PF02353

CMAS

Mycolic acid cyclopropane synthetase

32

172

0.82

PF13847

Methyltransf_31

Methyltransferase domain

44

214

0.8

PF13489

Methyltransf_23

Methyltransferase domain

29

198

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vc2-assembly12.cif.gz_L crystal structure of geranyl diphosphate c-methyltransferase from streptomyces coelicolor a3(2) in complex with mg2+, geranyl diphosphate, and s-adenosyl-l-homocysteine 0.8065 42 246
3vc2-assembly6.cif.gz_F crystal structure of geranyl diphosphate c-methyltransferase from streptomyces coelicolor a3(2) in complex with mg2+, geranyl diphosphate, and s-adenosyl-l-homocysteine 0.8064 42 246
3vc2-assembly3.cif.gz_C crystal structure of geranyl diphosphate c-methyltransferase from streptomyces coelicolor a3(2) in complex with mg2+, geranyl diphosphate, and s-adenosyl-l-homocysteine 0.8031 42 246
3bus-assembly1.cif.gz_A crystal structure of rebm 0.8019 42 246
4f86-assembly2.cif.gz_J structure analysis of geranyl diphosphate methyltransferase in complex with gpp and sinefungin 0.7979 42 246
ID Description Score Start End Superfamily
af_Q4CMB6_37_161_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8717 46 109 3.40.50.150
2o57A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8687 42 155 3.40.50.150
af_Q4CM63_15_263_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8666 42 174 3.40.50.150
af_A0A0P0Y1E1_35_188_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8613 42 176 3.40.50.150
af_Q553T0_166_421_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8474 41 173 3.40.50.150
ID Description Score Start End GO Terms
AF-D5ZVX0-F1-model_v4 Methyltransferase type 11 0.9405 14 246 GO:0008168
GO:0009058
GO:0032259
AF-A0A285DHQ5-F1-model_v4 deleted 0.9383 8 247
AF-A0A4T9WGU1-F1-model_v4 deleted 0.934 14 246
AF-A0A7C9HQD6-F1-model_v4 Methyltransferase domain-containing protein 0.9334 36 247 GO:0008168
GO:0032259
AF-S0G6S7-F1-model_v4 Methyltransferase type 11,CMAS family protein 0.9175 1 251 GO:0008168
GO:0032259

Map