F255307

General Info

Members Datasets Scaffolds Average Seq Length
169 133 166 115

Family's Representative Sequence

Representative Sequence 3300044765|Ga0466970_0025823|Ga0466970_0025823_373_744
Length 123
Sequence MVEQTDPLSQAFAALADPTRRDLVARLAAGGDATVSELAAPYAMSLQAVSKHLGVLEDAGVVTRTRTGRSRTVHLDAEVFDLMTKWIERYRREAEQRYRRLDAVLATLGEQEQPDEDREGEAS

Samples

Sample ID Description Type Environment
1 2643221674 Devosia sp. Root436 Isolate Unclassified
2 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
3 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
41 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
69 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
72 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
73 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
74 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
75 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
79 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
80 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
81 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
82 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
88 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
89 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
90 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
91 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
92 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
93 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
94 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
95 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
96 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
97 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
109 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
110 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
111 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
112 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
113 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
114 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
115 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
116 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
117 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
118 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
119 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
120 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
123 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
124 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
125 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
126 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
127 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
128 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
129 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
130 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
131 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
132 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
133 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.22
Metatranscriptomes 0
Isolates 1.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.51
Nodule 0
Rhizoplane 1.18
Rhizosphere 90.53
Stem 0
Stem Tuber 0
Unclassified 1.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10034663 3300003373 Bacteria 1301
2 Ga0070676_10333004 3300005328 Bacteria 1039
3 Ga0070683_100205261 3300005329 Bacteria 1872
4 Ga0070683_100348318 3300005329 Bacteria 1411
5 Ga0070683_100645125 3300005329 Bacteria 1014
6 Ga0070683_101351007 3300005329 Bacteria 685
7 Ga0070680_100093760 3300005336 Bacteria 2488
8 Ga0070682_100497235 3300005337 Bacteria 944
9 Ga0070674_101319176 3300005356 Bacteria 644
10 Ga0070659_100580406 3300005366 Bacteria 962
11 Ga0070714_100000005 3300005435 Bacteria 310514
12 Ga0070713_101229923 3300005436 Bacteria 725
13 Ga0070708_100000185 3300005445 Bacteria 45167
14 Ga0070685_11343717 3300005466 Bacteria 547
15 Ga0070706_100142942 3300005467 Bacteria 2234
16 Ga0070706_100287543 3300005467 Bacteria 1534
17 Ga0070707_100290366 3300005468 Bacteria 1589
18 Ga0070698_100110857 3300005471 Bacteria 2709
19 Ga0070699_100454128 3300005518 Bacteria 1162
20 Ga0070679_100024576 3300005530 Bacteria 5906
21 Ga0070684_100132632 3300005535 Bacteria 2248
22 Ga0070704_102238985 3300005549 Bacteria 508
23 Ga0070664_101138055 3300005564 Bacteria 735
24 Ga0070702_101641505 3300005615 Bacteria 533
25 Ga0068859_103075838 3300005617 Bacteria 509
26 Ga0081455_10065485 3300005937 Bacteria 3039
27 Ga0081538_10007333 3300005981 Bacteria 9551
28 Ga0081538_10071612 3300005981 Bacteria 1906
29 Ga0081540_1167480 3300005983 Bacteria 842
30 Ga0081539_10005785 3300005985 Bacteria 12319
31 Ga0070717_10037442 3300006028 Bacteria 3939
32 Ga0075364_10055558 3300006051 Bacteria 2590
33 Ga0075369_10121572 3300006186 Bacteria 1182
34 Ga0075366_10011758 3300006195 Bacteria 4949
35 Ga0075428_100095515 3300006844 Bacteria 3240
36 Ga0075428_102170076 3300006844 Bacteria 573
37 Ga0075429_100035335 3300006880 Bacteria 4347
38 Ga0097620_103076350 3300006931 Bacteria 509
39 Ga0111539_10016559 3300009094 Bacteria 9140
40 Ga0111539_11703213 3300009094 Bacteria 731
41 Ga0105245_11377345 3300009098 Bacteria 755
42 Ga0114129_12856967 3300009147 Bacteria 572
43 Ga0105249_12624422 3300009553 Bacteria 576
44 Ga0105030_103071 3300009987 Bacteria 1444
45 Ga0105028_109072 3300009993 Bacteria 1042
46 Ga0105239_10082759 3300010375 Bacteria 3534
47 Ga0105246_11160643 3300011119 Bacteria 709
48 Ga0157369_10013521 3300013105 Bacteria 9224
49 Ga0163162_10255490 3300013306 Bacteria 1884
50 Ga0163162_11279127 3300013306 Bacteria 833
51 Ga0157372_10854668 3300013307 Bacteria 1056
52 Ga0163163_10391623 3300014325 Bacteria 1447
53 Ga0157380_11498594 3300014326 Bacteria 728
54 Ga0157376_10809637 3300014969 Bacteria 950
55 Ga0163161_10492051 3300017792 Bacteria 997
56 Ga0163161_11069649 3300017792 Bacteria 692
57 Ga0213871_10013667 3300021441 Bacteria 1912
58 Ga0207684_10157382 3300025910 Bacteria 1956
59 Ga0207684_10177924 3300025910 Bacteria 1834
60 Ga0207684_11731345 3300025910 Bacteria 503
61 Ga0207707_11500181 3300025912 Unclassified 534
62 Ga0207660_11284879 3300025917 Unclassified 594
63 Ga0207652_10090965 3300025921 Bacteria 2682
64 Ga0207646_10856879 3300025922 Bacteria 807
65 Ga0207694_10984339 3300025924 Bacteria 714
66 Ga0207664_10000049 3300025929 Bacteria 134645
67 Ga0207706_11313957 3300025933 Bacteria 597
68 Ga0207711_11702603 3300025941 Bacteria 574
69 Ga0207661_10381718 3300025944 Bacteria 1275
70 Ga0207661_10410863 3300025944 Bacteria 1228
71 Ga0207661_10487537 3300025944 Bacteria 1126
72 Ga0207677_10750134 3300026023 Bacteria 870
73 Ga0207678_10334443 3300026067 Bacteria 1304
74 Ga0207708_10880360 3300026075 Bacteria 774
75 Ga0207702_10376470 3300026078 Bacteria 1364
76 Ga0207674_10721442 3300026116 Bacteria 962
77 Ga0207683_10552557 3300026121 Bacteria 1065
78 Ga0207428_10803494 3300027907 Bacteria 668
79 Ga0307515_10060215 3300028794 Bacteria 5421
80 Ga0307408_100206500 3300031548 Bacteria 1594
81 Ga0316575_10017322 3300031665 Bacteria 2736
82 Ga0316575_10082865 3300031665 Bacteria 1294
83 Ga0316578_10049223 3300031728 Bacteria 2462
84 Ga0307413_10624894 3300031824 Bacteria 885
85 Ga0307410_10410667 3300031852 Bacteria 1096
86 Ga0307406_10183679 3300031901 Bacteria 1525
87 Ga0307409_100896295 3300031995 Bacteria 900
88 Ga0307409_102270430 3300031995 Bacteria 572
89 Ga0307416_100560454 3300032002 Bacteria 1217
90 Ga0307416_100779468 3300032002 Bacteria 1051
91 Ga0307416_102244315 3300032002 Bacteria 647
92 Ga0307411_11695951 3300032005 Bacteria 585
93 Ga0307415_100773182 3300032126 Bacteria 874
94 Ga0307415_100856614 3300032126 Bacteria 834
95 Ga0316574_0342643 3300035398 Bacteria 946
96 Ga0316582_0130054 3300036647 Bacteria 1690
97 Ga0395899_0168813 3300037312 Bacteria 1542
98 Ga0395900_0094259 3300037418 Bacteria 3075
99 Ga0395898_0062082 3300037466 Bacteria 3630
100 Ga0395898_0188266 3300037466 Bacteria 1972
101 Ga0395905_0000938 3300037471 Bacteria 37508
102 Ga0395901_0090276 3300038443 Bacteria 3207
103 Ga0466970_0025823 3300044765 Bacteria 3077
104 Ga0466957_0007398 3300044842 Bacteria 6206
105 Ga0466959_0096784 3300045049 Bacteria 2116
106 Ga0495603_0490711 3300046455 Bacteria 703
107 Ga0495644_0193636 3300046523 Bacteria 783
108 Ga0495656_0090436 3300046615 Bacteria 1399
109 Ga0495659_0228104 3300046664 Bacteria 771
110 Ga0495589_0224124 3300046794 Bacteria 883
111 Ga0496100_1557921 3300048903 Bacteria 522
112 Ga0496114_0695352 3300048917 Bacteria 892
113 Ga0501031_0502301 3300049568 Bacteria 782
114 Ga0501032_0336695 3300049569 Bacteria 973
115 Ga0501032_0634857 3300049569 Bacteria 679
116 Ga0501033_0130545 3300049570 Bacteria 1820
117 Ga0501033_0511788 3300049570 Bacteria 830
118 Ga0501034_0263356 3300049571 Bacteria 1666
119 Ga0501036_0109843 3300049572 Bacteria 2330
120 Ga0501036_0329701 3300049572 Bacteria 1275
121 Ga0501039_0461820 3300049575 Bacteria 997
122 Ga0501040_0251048 3300049576 Bacteria 1262
123 Ga0501040_1343716 3300049576 Bacteria 519
124 Ga0501042_0186923 3300049578 Bacteria 1494
125 Ga0501042_0482235 3300049578 Unclassified 900
126 Ga0501043_0067807 3300049579 Bacteria 2802
127 Ga0501046_0021388 3300049580 Bacteria 5338
128 Ga0501046_0539848 3300049580 Bacteria 832
129 Ga0501047_0081648 3300049581 Bacteria 3107
130 Ga0501069_0205945 3300049585 Unclassified 1141
131 Ga0501069_0839675 3300049585 Bacteria 558
132 Ga0501070_0128699 3300049586 Bacteria 2092
133 Ga0501072_0107166 3300049588 Bacteria 2222
134 Ga0501072_0418381 3300049588 Unclassified 1062
135 Ga0501074_0395110 3300049590 Unclassified 981
136 Ga0501075_0276302 3300049591 Bacteria 1280
137 Ga0501075_0455772 3300049591 Bacteria 975
138 Ga0501075_0925563 3300049591 Bacteria 663
139 Ga0501076_0080891 3300049592 Bacteria 2608
140 Ga0501076_0640333 3300049592 Unclassified 877
141 Ga0501076_1379648 3300049592 Bacteria 579
142 Ga0501077_0031683 3300049593 Bacteria 3364
143 Ga0501077_0146239 3300049593 Bacteria 1499
144 Ga0501235_094230 3300049669 Bacteria 726
145 Ga0501079_0284696 3300049741 Bacteria 1292
146 Ga0501080_0134470 3300049742 Bacteria 2289
147 Ga0501081_0046606 3300049743 Bacteria 2980
148 Ga0501081_0555177 3300049743 Bacteria 858
149 Ga0501081_0930911 3300049743 Bacteria 656
150 Ga0501081_1145116 3300049743 Bacteria 589
151 Ga0501083_0221789 3300049744 Bacteria 1232
152 Ga0501035_0017635 3300049822 Bacteria 6586
153 Ga0501044_0045688 3300049823 Bacteria 4537
154 Ga0501045_0328104 3300049824 Unclassified 1139
155 nmdc:mga0k408_219326_c1 3300050493 Bacteria 1136
156 nmdc:mga06r32_1085042_c1 3300050510 Bacteria 750
157 nmdc:mga0sz30_133439_c1 3300050516 Bacteria 1095
158 Ga0500646_0018874 3300053090 Bacteria 1820
159 Ga0500555_001066 3300053103 Bacteria 9216
160 Ga0500562_004403 3300053108 Bacteria 3564
161 Ga0500593_033501 3300053117 Bacteria 2300
162 Ga0500616_0049172 3300053153 Bacteria 2232
163 Ga0500645_003704 3300053730 Bacteria 6090
164 Ga0501084_0262431 3300054114 Bacteria 1458
165 Ga0501084_0407264 3300054114 Bacteria 1149
166 Ga0501082_1022059 3300060353 Bacteria 723

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006844 Ga0075428_102170076 Ga0075428_1021700762 100
2 3300031548 Ga0307408_100206500 Ga0307408_1002065002 100
3 3300031901 Ga0307406_10183679 Ga0307406_101836792 100
4 3300032002 Ga0307416_100779468 Ga0307416_1007794682 100
5 3300006844 Ga0075428_100095515 Ga0075428_1000955151 103
6 3300006880 Ga0075429_100035335 Ga0075429_1000353355 103
7 3300009094 Ga0111539_10016559 Ga0111539_100165596 103
8 3300011119 Ga0105246_11160643 Ga0105246_111606432 103
9 3300050516 nmdc:mga0sz30_133439_c1 nmdc:mga0sz30_133439_c1_12_365 103
10 iso_pu_bacteria 2643221674 2644411110 103
11 iso_pu_bacteria 2833709550 2833710810 103
12 3300013105 Ga0157369_10013521 Ga0157369_100135217 104
13 iso_pu_bacteria 2861520306 2861522544 104
14 3300005328 Ga0070676_10333004 Ga0070676_103330042 105
15 3300009147 Ga0114129_12856967 Ga0114129_128569672 105
16 3300025910 Ga0207684_11731345 Ga0207684_117313451 105
17 3300037312 Ga0395899_0168813 Ga0395899_0168813_604_921 105
18 3300037418 Ga0395900_0094259 Ga0395900_0094259_417_734 105
19 3300053108 Ga0500562_004403 Ga0500562_004403_230_556 105
20 3300005329 Ga0070683_100348318 Ga0070683_1003483183 106
21 3300005329 Ga0070683_101351007 Ga0070683_1013510072 106
22 3300005366 Ga0070659_100580406 Ga0070659_1005804062 106
23 3300005466 Ga0070685_11343717 Ga0070685_113437171 106
24 3300005983 Ga0081540_1167480 Ga0081540_11674801 106
25 3300021441 Ga0213871_10013667 Ga0213871_100136673 106
26 3300025944 Ga0207661_10410863 Ga0207661_104108633 106
27 3300025944 Ga0207661_10487537 Ga0207661_104875372 106
28 3300026023 Ga0207677_10750134 Ga0207677_107501342 106
29 3300026121 Ga0207683_10552557 Ga0207683_105525572 106
30 3300044842 Ga0466957_0007398 Ga0466957_0007398_3134_3457 106
31 3300005436 Ga0070713_101229923 Ga0070713_1012299231 107
32 3300009094 Ga0111539_11703213 Ga0111539_117032131 107
33 3300031852 Ga0307410_10410667 Ga0307410_104106671 107
34 3300032005 Ga0307411_11695951 Ga0307411_116959512 107
35 3300003373 JGI25407J50210_10034663 JGI25407J50210_100346632 108
36 3300005329 Ga0070683_100205261 Ga0070683_1002052614 108
37 3300005329 Ga0070683_100645125 Ga0070683_1006451253 108
38 3300005336 Ga0070680_100093760 Ga0070680_1000937602 108
39 3300005337 Ga0070682_100497235 Ga0070682_1004972351 108
40 3300005356 Ga0070674_101319176 Ga0070674_1013191762 108
41 3300005435 Ga0070714_100000005 Ga0070714_100000005232 108
42 3300005445 Ga0070708_100000185 Ga0070708_1000001855 108
43 3300005467 Ga0070706_100142942 Ga0070706_1001429422 108
44 3300005467 Ga0070706_100287543 Ga0070706_1002875433 108
45 3300005468 Ga0070707_100290366 Ga0070707_1002903662 108
46 3300005471 Ga0070698_100110857 Ga0070698_1001108573 108
47 3300005518 Ga0070699_100454128 Ga0070699_1004541282 108
48 3300005530 Ga0070679_100024576 Ga0070679_1000245762 108
49 3300005535 Ga0070684_100132632 Ga0070684_1001326323 108
50 3300005549 Ga0070704_102238985 Ga0070704_1022389851 108
51 3300005564 Ga0070664_101138055 Ga0070664_1011380552 108
52 3300005615 Ga0070702_101641505 Ga0070702_1016415052 108
53 3300005617 Ga0068859_103075838 Ga0068859_1030758381 108
54 3300005937 Ga0081455_10065485 Ga0081455_100654852 108
55 3300005981 Ga0081538_10007333 Ga0081538_100073333 108
56 3300005981 Ga0081538_10071612 Ga0081538_100716122 108
57 3300005985 Ga0081539_10005785 Ga0081539_100057859 108
58 3300006028 Ga0070717_10037442 Ga0070717_100374424 108
59 3300006051 Ga0075364_10055558 Ga0075364_100555583 108
60 3300006186 Ga0075369_10121572 Ga0075369_101215722 108
61 3300006195 Ga0075366_10011758 Ga0075366_100117585 108
62 3300006931 Ga0097620_103076350 Ga0097620_1030763502 108
63 3300009098 Ga0105245_11377345 Ga0105245_113773452 108
64 3300009553 Ga0105249_12624422 Ga0105249_126244222 108
65 3300009987 Ga0105030_103071 Ga0105030_1030712 108
66 3300009993 Ga0105028_109072 Ga0105028_1090722 108
67 3300010375 Ga0105239_10082759 Ga0105239_100827592 108
68 3300013306 Ga0163162_10255490 Ga0163162_102554901 108
69 3300013306 Ga0163162_11279127 Ga0163162_112791272 108
70 3300013307 Ga0157372_10854668 Ga0157372_108546681 108
71 3300014325 Ga0163163_10391623 Ga0163163_103916233 108
72 3300014326 Ga0157380_11498594 Ga0157380_114985942 108
73 3300014969 Ga0157376_10809637 Ga0157376_108096371 108
74 3300017792 Ga0163161_10492051 Ga0163161_104920511 108
75 3300017792 Ga0163161_11069649 Ga0163161_110696492 108
76 3300025910 Ga0207684_10157382 Ga0207684_101573822 108
77 3300025910 Ga0207684_10177924 Ga0207684_101779243 108
78 3300025912 Ga0207707_11500181 Ga0207707_115001811 108
79 3300025917 Ga0207660_11284879 Ga0207660_112848792 108
80 3300025921 Ga0207652_10090965 Ga0207652_100909652 108
81 3300025922 Ga0207646_10856879 Ga0207646_108568791 108
82 3300025924 Ga0207694_10984339 Ga0207694_109843391 108
83 3300025929 Ga0207664_10000049 Ga0207664_1000004961 108
84 3300025933 Ga0207706_11313957 Ga0207706_113139572 108
85 3300025941 Ga0207711_11702603 Ga0207711_117026031 108
86 3300025944 Ga0207661_10381718 Ga0207661_103817183 108
87 3300026067 Ga0207678_10334443 Ga0207678_103344432 108
88 3300026075 Ga0207708_10880360 Ga0207708_108803602 108
89 3300026078 Ga0207702_10376470 Ga0207702_103764701 108
90 3300026116 Ga0207674_10721442 Ga0207674_107214422 108
91 3300027907 Ga0207428_10803494 Ga0207428_108034942 108
92 3300028794 Ga0307515_10060215 Ga0307515_100602154 108
93 3300031665 Ga0316575_10017322 Ga0316575_100173224 108
94 3300031665 Ga0316575_10082865 Ga0316575_100828653 108
95 3300031728 Ga0316578_10049223 Ga0316578_100492232 108
96 3300031824 Ga0307413_10624894 Ga0307413_106248941 108
97 3300031995 Ga0307409_100896295 Ga0307409_1008962951 108
98 3300031995 Ga0307409_102270430 Ga0307409_1022704302 108
99 3300032002 Ga0307416_100560454 Ga0307416_1005604542 108
100 3300032002 Ga0307416_102244315 Ga0307416_1022443152 108
101 3300032126 Ga0307415_100773182 Ga0307415_1007731821 108
102 3300032126 Ga0307415_100856614 Ga0307415_1008566141 108
103 3300035398 Ga0316574_0342643 Ga0316574_0342643_394_780 108
104 3300036647 Ga0316582_0130054 Ga0316582_0130054_344_730 108
105 3300037466 Ga0395898_0062082 Ga0395898_0062082_2496_2834 108
106 3300037466 Ga0395898_0188266 Ga0395898_0188266_1434_1766 108
107 3300037471 Ga0395905_0000938 Ga0395905_0000938_23766_24095 108
108 3300038443 Ga0395901_0090276 Ga0395901_0090276_2145_2477 108
109 3300044765 Ga0466970_0025823 Ga0466970_0025823_373_744 108
110 3300045049 Ga0466959_0096784 Ga0466959_0096784_625_996 108
111 3300046455 Ga0495603_0490711 Ga0495603_0490711_84_440 108
112 3300046523 Ga0495644_0193636 Ga0495644_0193636_306_665 108
113 3300046615 Ga0495656_0090436 Ga0495656_0090436_321_659 108
114 3300046664 Ga0495659_0228104 Ga0495659_0228104_202_540 108
115 3300046794 Ga0495589_0224124 Ga0495589_0224124_347_685 108
116 3300048903 Ga0496100_1557921 Ga0496100_1557921_122_460 108
117 3300048917 Ga0496114_0695352 Ga0496114_0695352_101_475 108
118 3300049568 Ga0501031_0502301 Ga0501031_0502301_128_460 108
119 3300049569 Ga0501032_0336695 Ga0501032_0336695_261_608 108
120 3300049569 Ga0501032_0634857 Ga0501032_0634857_214_543 108
121 3300049570 Ga0501033_0130545 Ga0501033_0130545_1276_1623 108
122 3300049570 Ga0501033_0511788 Ga0501033_0511788_147_509 108
123 3300049571 Ga0501034_0263356 Ga0501034_0263356_446_793 108
124 3300049572 Ga0501036_0109843 Ga0501036_0109843_834_1181 108
125 3300049572 Ga0501036_0329701 Ga0501036_0329701_262_591 108
126 3300049575 Ga0501039_0461820 Ga0501039_0461820_271_621 108
127 3300049576 Ga0501040_0251048 Ga0501040_0251048_765_1130 108
128 3300049576 Ga0501040_1343716 Ga0501040_1343716_160_489 108
129 3300049578 Ga0501042_0186923 Ga0501042_0186923_976_1335 108
130 3300049578 Ga0501042_0482235 Ga0501042_0482235_179_508 108
131 3300049579 Ga0501043_0067807 Ga0501043_0067807_1924_2271 108
132 3300049580 Ga0501046_0021388 Ga0501046_0021388_89_451 108
133 3300049580 Ga0501046_0539848 Ga0501046_0539848_344_691 108
134 3300049581 Ga0501047_0081648 Ga0501047_0081648_359_706 108
135 3300049585 Ga0501069_0205945 Ga0501069_0205945_354_683 108
136 3300049585 Ga0501069_0839675 Ga0501069_0839675_187_537 108
137 3300049586 Ga0501070_0128699 Ga0501070_0128699_966_1313 108
138 3300049588 Ga0501072_0107166 Ga0501072_0107166_1366_1725 108
139 3300049588 Ga0501072_0418381 Ga0501072_0418381_185_547 108
140 3300049590 Ga0501074_0395110 Ga0501074_0395110_459_788 108
141 3300049591 Ga0501075_0276302 Ga0501075_0276302_384_743 108
142 3300049591 Ga0501075_0455772 Ga0501075_0455772_31_393 108
143 3300049591 Ga0501075_0925563 Ga0501075_0925563_38_367 108
144 3300049592 Ga0501076_0080891 Ga0501076_0080891_1308_1667 108
145 3300049592 Ga0501076_0640333 Ga0501076_0640333_468_797 108
146 3300049592 Ga0501076_1379648 Ga0501076_1379648_178_507 108
147 3300049593 Ga0501077_0031683 Ga0501077_0031683_16_378 108
148 3300049593 Ga0501077_0146239 Ga0501077_0146239_1086_1445 108
149 3300049669 Ga0501235_094230 Ga0501235_094230_10_393 108
150 3300049741 Ga0501079_0284696 Ga0501079_0284696_116_475 108
151 3300049742 Ga0501080_0134470 Ga0501080_0134470_414_761 108
152 3300049743 Ga0501081_0046606 Ga0501081_0046606_460_819 108
153 3300049743 Ga0501081_0555177 Ga0501081_0555177_111_443 108
154 3300049743 Ga0501081_0930911 Ga0501081_0930911_133_465 108
155 3300049743 Ga0501081_1145116 Ga0501081_1145116_202_540 108
156 3300049744 Ga0501083_0221789 Ga0501083_0221789_750_1097 108
157 3300049822 Ga0501035_0017635 Ga0501035_0017635_3321_3668 108
158 3300049823 Ga0501044_0045688 Ga0501044_0045688_1679_2026 108
159 3300049824 Ga0501045_0328104 Ga0501045_0328104_217_546 108
160 3300050493 nmdc:mga0k408_219326_c1 nmdc:mga0k408_219326_c1_630_998 108
161 3300050510 nmdc:mga06r32_1085042_c1 nmdc:mga06r32_1085042_c1_40_390 108
162 3300053090 Ga0500646_0018874 Ga0500646_0018874_706_1074 108
163 3300053103 Ga0500555_001066 Ga0500555_001066_3505_3873 108
164 3300053117 Ga0500593_033501 Ga0500593_033501_1335_1682 108
165 3300053153 Ga0500616_0049172 Ga0500616_0049172_329_703 108
166 3300053730 Ga0500645_003704 Ga0500645_003704_3472_3840 108
167 3300054114 Ga0501084_0262431 Ga0501084_0262431_410_772 108
168 3300054114 Ga0501084_0407264 Ga0501084_0407264_608_967 108
169 3300060353 Ga0501082_1022059 Ga0501082_1022059_38_367 108

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

17

64

0.97

PF12840

HTH_20

Helix-turn-helix domain

15

65

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9537 4 89
7p6f-assembly2.cif.gz_CCC-2 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9456 4 89
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.9092 17 73
3f6o-assembly1.cif.gz_B crystal structure of arsr family transcriptional regulator, rha00566 0.9083 5 92
2quf-assembly1.cif.gz_A crystal structure of transcription factor axxa-pf0095 from pyrococcus furiosus 0.9058 9 73
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9478 15 71 1.10.10.10
af_P71941_17_120_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9386 4 84 1.10.10.10
af_Q2FXF7_1_94_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9326 1 86 1.10.10.10
af_I6Y1A7_25_116_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9306 5 84 1.10.10.10
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9281 9 72 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A3S9VAS7-F1-model_v4 ArsR family transcriptional regulator 0.985 7 86 GO:0003700
AF-A0A7W0YP81-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9832 4 89 GO:0003700
AF-A0A350UIW9-F1-model_v4 Transcriptional regulator 0.9756 1 86 GO:0003700
AF-A0A4R1RUL3-F1-model_v4 Helix-turn-helix protein 0.9756 6 88 GO:0003700
AF-A0A2W5VFY7-F1-model_v4 HTH arsR-type domain-containing protein 0.9755 2 86 GO:0003700

Feature Viewer

pLDDT pTM Quality
92.65 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map