F255283

General Info

Members Datasets Scaffolds Average Seq Length
169 94 338 205

Family's Representative Sequence

Representative Sequence 3300044693|Ga0466961_0060661|Ga0466961_0060661_1096_1743
Length 215
Sequence MVIAIDGPAGAGKSTVARAVAATLGFTYLDSGAMYRAVALAALRAGRPPAEIADGVRIEVGDRVLLDGEDVTQEIRTAAVSQAASRAASDPSVRAAMVAQQRQVLQSHGSWVAEGRDIGTVVAPDAELKVYLDADPAERARRRAAELGGDPATVLAEQAIRDERDRTRAHSPLEPAPGAVALDTTGLTLAEVVGEVVKLAREKSGRELDPGRASD

Samples

Sample ID Description Type Environment
1 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
17 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
20 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
21 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
22 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
23 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
24 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
38 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
39 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
40 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
41 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
42 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
43 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
44 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
45 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
46 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
47 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
48 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
49 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
50 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
51 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
52 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
53 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
54 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
55 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
56 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
57 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
58 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
59 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
60 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
61 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
62 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
63 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
64 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
65 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
66 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
67 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
68 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
69 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
70 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
71 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
72 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
73 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
74 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
75 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
76 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
77 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
78 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
79 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
80 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
81 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
82 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
83 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
84 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
85 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
86 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
87 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
88 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
89 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
90 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
91 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
92 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
93 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
94 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.59
Nodule 0
Rhizoplane 4.73
Rhizosphere 73.37
Stem 0
Stem Tuber 0
Unclassified 5.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466961_0060661 3300044693 Bacteria 2405
2 Ga0070676_10173658 3300005328 Bacteria 1396
3 Ga0070683_100122543 3300005329 Bacteria 2456
4 Ga0070668_100063684 3300005347 Bacteria 2858
5 Ga0070669_100163028 3300005353 Bacteria 1734
6 Ga0070659_100000013 3300005366 Bacteria 178795
7 Ga0070714_100000137 3300005435 Bacteria 58260
8 Ga0070714_100006405 3300005435 Bacteria 9090
9 Ga0070714_100449459 3300005435 Bacteria 1224
10 Ga0070714_100809588 3300005435 Bacteria 907
11 Ga0070714_101260563 3300005435 Bacteria 721
12 Ga0070713_100301876 3300005436 Bacteria 1474
13 Ga0070713_100428367 3300005436 Bacteria 1239
14 Ga0070710_10000005 3300005437 Bacteria 238049
15 Ga0070710_10008286 3300005437 Bacteria 5060
16 Ga0070711_100879429 3300005439 Bacteria 764
17 Ga0068867_100427958 3300005459 Bacteria 1123
18 Ga0070684_100306993 3300005535 Bacteria 1457
19 Ga0070665_100920227 3300005548 Bacteria 887
20 Ga0070664_100562824 3300005564 Bacteria 1055
21 Ga0068852_100496550 3300005616 Bacteria 1215
22 Ga0070717_10002745 3300006028 Bacteria 12439
23 Ga0070717_10496710 3300006028 Bacteria 1102
24 Ga0075365_10373194 3300006038 Unclassified 1006
25 Ga0070712_100000002 3300006175 Bacteria 288475
26 Ga0070712_100005965 3300006175 Bacteria 7532
27 Ga0070712_100349825 3300006175 Bacteria 1209
28 Ga0105249_10541503 3300009553 Bacteria 1214
29 Ga0105246_10021328 3300011119 Bacteria 4167
30 Ga0213874_10032854 3300021377 Bacteria 1509
31 Ga0213876_10014447 3300021384 Bacteria 4182
32 Ga0213876_10018470 3300021384 Bacteria 3683
33 Ga0213876_10019919 3300021384 Bacteria 3543
34 Ga0213876_10022868 3300021384 Bacteria 3303
35 Ga0213876_10045634 3300021384 Bacteria 2317
36 Ga0213876_10056244 3300021384 Bacteria 2077
37 Ga0213876_10090700 3300021384 Bacteria 1618
38 Ga0213875_10013713 3300021388 Bacteria 3971
39 Ga0213875_10104204 3300021388 Bacteria 1324
40 Ga0207692_10000009 3300025898 Bacteria 159859
41 Ga0207692_10162075 3300025898 Bacteria 1289
42 Ga0207692_10259616 3300025898 Bacteria 1044
43 Ga0207645_10202762 3300025907 Bacteria 1305
44 Ga0207693_10000014 3300025915 Bacteria 148984
45 Ga0207693_10000327 3300025915 Bacteria 43947
46 Ga0207693_10148936 3300025915 Bacteria 1840
47 Ga0207663_10030077 3300025916 Bacteria 3199
48 Ga0207700_10005805 3300025928 Bacteria 7412
49 Ga0207700_10465049 3300025928 Bacteria 1116
50 Ga0207664_10000006 3300025929 Bacteria 408702
51 Ga0207664_10587407 3300025929 Bacteria 1000
52 Ga0207690_10000017 3300025932 Bacteria 243513
53 Ga0207668_10074530 3300025972 Bacteria 2437
54 Ga0207640_10375786 3300025981 Bacteria 1150
55 Ga0207658_10412843 3300025986 Bacteria 1189
56 Ga0207648_10495479 3300026089 Bacteria 1117
57 Ga0207675_100657919 3300026118 Bacteria 1054
58 Ga0268264_10319097 3300028381 Bacteria 1468
59 Ga0265326_10000045 3300028558 Bacteria 79810
60 Ga0265319_1001118 3300028563 Bacteria 16704
61 Ga0265334_10000012 3300028573 Bacteria 174358
62 Ga0265336_10007515 3300028666 Bacteria 3873
63 Ga0265338_10003738 3300028800 Bacteria 21159
64 Ga0265324_10008556 3300029957 Bacteria 4061
65 Ga0373956_0228215 3300035119 Bacteria 884
66 Ga0373957_0019603 3300035120 Bacteria 2383
67 Ga0373937_0072054 3300036401 Bacteria 3186
68 Ga0395900_0003806 3300037418 Bacteria 16134
69 Ga0395898_0001796 3300037466 Bacteria 27829
70 Ga0436364_0047066 3300037853 Bacteria 5845
71 Ga0436364_0407949 3300037853 Bacteria 3127
72 Ga0436364_0697818 3300037853 Bacteria 1303
73 Ga0436364_0792922 3300037853 Bacteria 20571
74 Ga0436364_0938940 3300037853 Bacteria 10915
75 Ga0436364_1084261 3300037853 Bacteria 2254
76 Ga0436364_1120825 3300037853 Bacteria 7152
77 Ga0436364_1190550 3300037853 Bacteria 1221
78 Ga0436364_1394916 3300037853 Bacteria 7949
79 Ga0436364_1482777 3300037853 Bacteria 1131
80 Ga0436365_0113452 3300039437 Bacteria 4252
81 Ga0436365_0485053 3300039437 Bacteria 689
82 Ga0436365_0587903 3300039437 Bacteria 2383
83 Ga0436365_0697693 3300039437 Bacteria 2128
84 Ga0436365_0701194 3300039437 Bacteria 707
85 Ga0436365_0930107 3300039437 Bacteria 9500
86 Ga0436365_0963970 3300039437 Bacteria 2425
87 Ga0436365_0993307 3300039437 Bacteria 5147
88 Ga0436365_1221698 3300039437 Bacteria 2129
89 Ga0436365_1323408 3300039437 Bacteria 1558
90 Ga0436365_1591814 3300039437 Bacteria 7603
91 Ga0436365_1718940 3300039437 Bacteria 9259
92 Ga0436360_0275802 3300039438 Bacteria 1360
93 Ga0436363_0660807 3300039450 Bacteria 3546
94 Ga0436363_0805533 3300039450 Bacteria 51825
95 Ga0436363_1068383 3300039450 Bacteria 4477
96 Ga0436363_1705385 3300039450 Bacteria 1277
97 Ga0436362_1026826 3300039453 Bacteria 2435
98 Ga0436362_1139463 3300039453 Bacteria 1454
99 Ga0439459_0031055 3300042438 Bacteria 1087
100 Ga0466969_0042002 3300044656 Bacteria 2285
101 Ga0466965_0065030 3300044683 Bacteria 1827
102 Ga0466965_0148742 3300044683 Unclassified 1223
103 Ga0466965_0706260 3300044683 Bacteria 579
104 Ga0466966_0047869 3300044684 Bacteria 2725
105 Ga0466966_0252964 3300044684 Bacteria 1061
106 Ga0466966_0328581 3300044684 Bacteria 919
107 Ga0466966_0378381 3300044684 Bacteria 851
108 Ga0466961_0101020 3300044693 Unclassified 1817
109 Ga0466963_0001495 3300044694 Bacteria 12634
110 Ga0466963_0268215 3300044694 Bacteria 1199
111 Ga0466964_0143459 3300044706 Unclassified 1100
112 Ga0466971_0036545 3300044719 Bacteria 2203
113 Ga0466971_0129355 3300044719 Unclassified 1171
114 Ga0466971_0136179 3300044719 Bacteria 1142
115 Ga0466968_0171355 3300044735 Bacteria 1006
116 Ga0466968_0183744 3300044735 Unclassified 973
117 Ga0466968_0271334 3300044735 Bacteria 810
118 Ga0466970_0187894 3300044765 Unclassified 1147
119 Ga0466957_0002390 3300044842 Bacteria 10079
120 Ga0466957_0850838 3300044842 Bacteria 650
121 Ga0466959_0014352 3300045049 Bacteria 5752
122 Ga0466959_0024390 3300045049 Bacteria 4480
123 Ga0466959_0028869 3300045049 Bacteria 4110
124 Ga0466959_0041527 3300045049 Bacteria 3395
125 Ga0466959_0115711 3300045049 Bacteria 1910
126 Ga0466958_0002490 3300045836 Bacteria 9278
127 Ga0466958_0027041 3300045836 Bacteria 3394
128 Ga0466958_0092208 3300045836 Bacteria 1875
129 Ga0466958_0228830 3300045836 Unclassified 1187
130 Ga0466967_0010350 3300045976 Bacteria 6991
131 Ga0466967_0178569 3300045976 Bacteria 2001
132 Ga0466967_0579990 3300045976 Unclassified 1105
133 Ga0466967_0640528 3300045976 Bacteria 1051
134 Ga0495651_0060300 3300046462 Bacteria 2906
135 Ga0495653_0016337 3300046463 Bacteria 6047
136 Ga0495664_0043967 3300046477 Bacteria 2647
137 Ga0495664_0056654 3300046477 Bacteria 2332
138 Ga0495664_0099131 3300046477 Bacteria 1755
139 Ga0495608_0016723 3300046511 Bacteria 5075
140 Ga0495618_0083692 3300046514 Bacteria 2038
141 Ga0495628_0007246 3300046516 Bacteria 9604
142 Ga0495630_0000440 3300046517 Bacteria 31661
143 Ga0495652_0049609 3300046529 Bacteria 3593
144 Ga0495640_0054962 3300046533 Bacteria 2725
145 Ga0495587_0073866 3300046536 Bacteria 1981
146 Ga0495667_0001827 3300046559 Bacteria 14124
147 Ga0495667_0123704 3300046559 Bacteria 1670
148 Ga0495634_0013739 3300046642 Bacteria 5848
149 Ga0495635_0008028 3300046663 Bacteria 7373
150 Ga0495657_0000017 3300046675 Bacteria 174558
151 Ga0495657_0030037 3300046675 Bacteria 3808
152 Ga0495623_0023431 3300046679 Bacteria 3985
153 Ga0495674_0030787 3300047319 Bacteria 4877
154 Ga0495674_0043781 3300047319 Bacteria 3982
155 Ga0495680_0064511 3300047322 Bacteria 2808
156 Ga0495675_0012322 3300047444 Bacteria 5381
157 Ga0495684_0289021 3300047471 Bacteria 1181
158 Ga0495602_0018942 3300048088 Bacteria 6851
159 Ga0496100_0000156 3300048903 Bacteria 38167
160 Ga0496101_0020950 3300048904 Bacteria 4486
161 Ga0496104_0126502 3300048907 Bacteria 2454
162 Ga0496108_0117834 3300048911 Bacteria 2276
163 Ga0496109_0523300 3300048912 Bacteria 1119
164 Ga0496112_0001374 3300048915 Bacteria 18549
165 Ga0496113_0031761 3300048916 Bacteria 3835
166 Ga0496113_0699298 3300048916 Bacteria 809
167 Ga0495619_0014306 3300053085 Bacteria 5014
168 Ga0495619_0233989 3300053085 Bacteria 1273
169 Ga0466962_0020230 3300061719 Bacteria 3200
170 Ga0466961_0060661
171 Ga0070676_10173658
172 Ga0070683_100122543
173 Ga0070668_100063684
174 Ga0070669_100163028
175 Ga0070659_100000013
176 Ga0070714_100000137
177 Ga0070714_100006405
178 Ga0070714_100449459
179 Ga0070714_100809588
180 Ga0070714_101260563
181 Ga0070713_100301876
182 Ga0070713_100428367
183 Ga0070710_10000005
184 Ga0070710_10008286
185 Ga0070711_100879429
186 Ga0068867_100427958
187 Ga0070684_100306993
188 Ga0070665_100920227
189 Ga0070664_100562824
190 Ga0068852_100496550
191 Ga0070717_10002745
192 Ga0070717_10496710
193 Ga0075365_10373194
194 Ga0070712_100000002
195 Ga0070712_100005965
196 Ga0070712_100349825
197 Ga0105249_10541503
198 Ga0105246_10021328
199 Ga0213874_10032854
200 Ga0213876_10014447
201 Ga0213876_10018470
202 Ga0213876_10019919
203 Ga0213876_10022868
204 Ga0213876_10045634
205 Ga0213876_10056244
206 Ga0213876_10090700
207 Ga0213875_10013713
208 Ga0213875_10104204
209 Ga0207692_10000009
210 Ga0207692_10162075
211 Ga0207692_10259616
212 Ga0207645_10202762
213 Ga0207693_10000014
214 Ga0207693_10000327
215 Ga0207693_10148936
216 Ga0207663_10030077
217 Ga0207700_10005805
218 Ga0207700_10465049
219 Ga0207664_10000006
220 Ga0207664_10587407
221 Ga0207690_10000017
222 Ga0207668_10074530
223 Ga0207640_10375786
224 Ga0207658_10412843
225 Ga0207648_10495479
226 Ga0207675_100657919
227 Ga0268264_10319097
228 Ga0265326_10000045
229 Ga0265319_1001118
230 Ga0265334_10000012
231 Ga0265336_10007515
232 Ga0265338_10003738
233 Ga0265324_10008556
234 Ga0373956_0228215
235 Ga0373957_0019603
236 Ga0373937_0072054
237 Ga0395900_0003806
238 Ga0395898_0001796
239 Ga0436364_0047066
240 Ga0436364_0407949
241 Ga0436364_0697818
242 Ga0436364_0792922
243 Ga0436364_0938940
244 Ga0436364_1084261
245 Ga0436364_1120825
246 Ga0436364_1190550
247 Ga0436364_1394916
248 Ga0436364_1482777
249 Ga0436365_0113452
250 Ga0436365_0485053
251 Ga0436365_0587903
252 Ga0436365_0697693
253 Ga0436365_0701194
254 Ga0436365_0930107
255 Ga0436365_0963970
256 Ga0436365_0993307
257 Ga0436365_1221698
258 Ga0436365_1323408
259 Ga0436365_1591814
260 Ga0436365_1718940
261 Ga0436360_0275802
262 Ga0436363_0660807
263 Ga0436363_0805533
264 Ga0436363_1068383
265 Ga0436363_1705385
266 Ga0436362_1026826
267 Ga0436362_1139463
268 Ga0439459_0031055
269 Ga0466969_0042002
270 Ga0466965_0065030
271 Ga0466965_0148742
272 Ga0466965_0706260
273 Ga0466966_0047869
274 Ga0466966_0252964
275 Ga0466966_0328581
276 Ga0466966_0378381
277 Ga0466961_0101020
278 Ga0466963_0001495
279 Ga0466963_0268215
280 Ga0466964_0143459
281 Ga0466971_0036545
282 Ga0466971_0129355
283 Ga0466971_0136179
284 Ga0466968_0171355
285 Ga0466968_0183744
286 Ga0466968_0271334
287 Ga0466970_0187894
288 Ga0466957_0002390
289 Ga0466957_0850838
290 Ga0466959_0014352
291 Ga0466959_0024390
292 Ga0466959_0028869
293 Ga0466959_0041527
294 Ga0466959_0115711
295 Ga0466958_0002490
296 Ga0466958_0027041
297 Ga0466958_0092208
298 Ga0466958_0228830
299 Ga0466967_0010350
300 Ga0466967_0178569
301 Ga0466967_0579990
302 Ga0466967_0640528
303 Ga0495651_0060300
304 Ga0495653_0016337
305 Ga0495664_0043967
306 Ga0495664_0056654
307 Ga0495664_0099131
308 Ga0495608_0016723
309 Ga0495618_0083692
310 Ga0495628_0007246
311 Ga0495630_0000440
312 Ga0495652_0049609
313 Ga0495640_0054962
314 Ga0495587_0073866
315 Ga0495667_0001827
316 Ga0495667_0123704
317 Ga0495634_0013739
318 Ga0495635_0008028
319 Ga0495657_0000017
320 Ga0495657_0030037
321 Ga0495623_0023431
322 Ga0495674_0030787
323 Ga0495674_0043781
324 Ga0495680_0064511
325 Ga0495675_0012322
326 Ga0495684_0289021
327 Ga0495602_0018942
328 Ga0496100_0000156
329 Ga0496101_0020950
330 Ga0496104_0126502
331 Ga0496108_0117834
332 Ga0496109_0523300
333 Ga0496112_0001374
334 Ga0496113_0031761
335 Ga0496113_0699298
336 Ga0495619_0014306
337 Ga0495619_0233989
338 Ga0466962_0020230

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02224

Cytidylate_kin

Cytidylate kinase

3

202

0.94

PF13238

AAA_18

AAA domain

3

151

0.78

PF13207

AAA_17

AAA domain

7

161

0.68

PF13189

Cytidylate_kin2

Cytidylate kinase-like family

2

172

0.65

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r20-assembly1.cif.gz_A crystal structure of cytidylate kinase from mycobacterium smegmatis 0.8988 1 200
2feo-assembly1.cif.gz_A mutant r188m of the cytidine monophosphate kinase from e. coli complexed with dcmp 0.8869 2 204
1kdt-assembly1.cif.gz_A cytidine monophosphate kinase from e.coli in complex with 2',3'-dideoxy-cytidine monophosphate 0.8681 2 205
2feo-assembly1.cif.gz_A mutant r188m of the cytidine monophosphate kinase from e. coli complexed with dcmp 0.863 2 204
3r20-assembly1.cif.gz_A crystal structure of cytidylate kinase from mycobacterium smegmatis 0.8624 1 200
ID Description Score Start End Superfamily
2femA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.853 2 205 3.40.50.300
af_A0A1D8PMF8_1_74_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.8461 137 166 1.10.238.10
2femA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8338 2 205 3.40.50.300
2h92C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8299 1 204 3.40.50.300
4dieB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8182 1 204 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7Z1UX88-F1-model_v4 deleted 0.9612 2 123
AF-A0A1Q3JMQ5-F1-model_v4 (d)CMP kinase (EC 2.7.4.25) 0.9589 1 161 GO:0004127
GO:0005524
AF-A0A562NTJ0-F1-model_v4 Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase) 0.958 1 207 GO:0005524
GO:0005737
GO:0006220
GO:0036430
GO:0036431
AF-A0A7W6RZH5-F1-model_v4 Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase) 0.9577 1 205 GO:0004127
GO:0005524
GO:0005737
GO:0006220
GO:0016765
AF-A0A3B0RXE6-F1-model_v4 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) 0.9555 2 207 GO:0003866
GO:0005524
GO:0008652
GO:0009073
GO:0009423
GO:0036430
GO:0036431

Map