F255210
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 169 | 39 | 338 | 137 |
Family's Representative Sequence
| Representative Sequence | 3300041511|Ga0451855_0660358|Ga0451855_0660358_52_474 |
| Length | 140 |
| Sequence | MAERLKEIKRHTAIAKLNDVPTSPRKMRLVADLVRGVEVNRALDILHYSKKEASYRLEKLVRSAIANWEAKNEDSRKELENGNVYVQTIMVDGGRQLKRIRTAPQGRAARIRKRSNHVTVIVGTKNEKPAEEXXXXAAEA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 2 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 3 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 4 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 5 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 6 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 7 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 8 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 9 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 10 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 11 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 12 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 13 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 14 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 15 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 16 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 17 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 18 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 19 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 20 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 21 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 22 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 23 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 24 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 25 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 26 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 27 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 28 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 29 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 30 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 31 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 32 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 33 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 34 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 35 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 36 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 37 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 38 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 39 | 2890804823 | Fluviicola sp. SGL-29 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 75.15 |
| Metatranscriptomes | 24.26 |
| Isolates | 0.59 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.78 |
| Rhizosphere | 95.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0451855_0660358 | 3300041511 | Unclassified | 577 |
| 2 | Ga0265337_1121424 | 3300028556 | Bacteria | 709 |
| 3 | Ga0265323_10000040 | 3300028653 | Bacteria | 70373 |
| 4 | Ga0265323_10042928 | 3300028653 | Bacteria | 1635 |
| 5 | Ga0265322_10103016 | 3300028654 | Bacteria | 812 |
| 6 | Ga0265322_10188395 | 3300028654 | Bacteria | 591 |
| 7 | Ga0265338_10112920 | 3300028800 | Bacteria | 2184 |
| 8 | Ga0265330_10094920 | 3300031235 | Bacteria | 1279 |
| 9 | Ga0265320_10296510 | 3300031240 | Bacteria | 715 |
| 10 | Ga0265327_10000370 | 3300031251 | Bacteria | 84921 |
| 11 | Ga0265327_10156158 | 3300031251 | Bacteria | 1057 |
| 12 | Ga0265316_10000486 | 3300031344 | Bacteria | 45040 |
| 13 | Ga0265316_10002446 | 3300031344 | Bacteria | 19266 |
| 14 | Ga0265316_10004409 | 3300031344 | Bacteria | 14019 |
| 15 | Ga0265316_10042062 | 3300031344 | Bacteria | 3653 |
| 16 | Ga0265316_10165700 | 3300031344 | Bacteria | 1651 |
| 17 | Ga0316575_10033954 | 3300031665 | Bacteria | 2003 |
| 18 | Ga0316575_10104372 | 3300031665 | Bacteria | 1154 |
| 19 | Ga0316579_10026903 | 3300031691 | Bacteria | 2608 |
| 20 | Ga0316579_10046066 | 3300031691 | Bacteria | 2034 |
| 21 | Ga0265342_10050150 | 3300031712 | Bacteria | 2495 |
| 22 | Ga0265342_10627231 | 3300031712 | Bacteria | 541 |
| 23 | Ga0316576_10001965 | 3300031727 | Bacteria | 11485 |
| 24 | Ga0316576_10022758 | 3300031727 | Bacteria | 4356 |
| 25 | Ga0316576_10038621 | 3300031727 | Bacteria | 3424 |
| 26 | Ga0316576_10098247 | 3300031727 | Bacteria | 2186 |
| 27 | Ga0316576_10229398 | 3300031727 | Bacteria | 1396 |
| 28 | Ga0316576_10546595 | 3300031727 | Bacteria | 849 |
| 29 | Ga0316576_10787879 | 3300031727 | Bacteria | 685 |
| 30 | Ga0316578_10019064 | 3300031728 | Bacteria | 3770 |
| 31 | Ga0316578_10146420 | 3300031728 | Bacteria | 1423 |
| 32 | Ga0316578_10176241 | 3300031728 | Bacteria | 1289 |
| 33 | Ga0316578_10431435 | 3300031728 | Bacteria | 780 |
| 34 | Ga0316577_10008426 | 3300031733 | Bacteria | 5526 |
| 35 | Ga0316577_10292415 | 3300031733 | Bacteria | 923 |
| 36 | Ga0316577_10388487 | 3300031733 | Bacteria | 793 |
| 37 | Ga0316585_10002058 | 3300032137 | Bacteria | 5395 |
| 38 | Ga0316580_10011148 | 3300032139 | Bacteria | 2724 |
| 39 | Ga0316580_10016205 | 3300032139 | Bacteria | 2285 |
| 40 | Ga0316580_10092201 | 3300032139 | Unclassified | 927 |
| 41 | Ga0316593_10000279 | 3300032168 | Bacteria | 8591 |
| 42 | Ga0316593_10010130 | 3300032168 | Bacteria | 2691 |
| 43 | Ga0316593_10014736 | 3300032168 | Bacteria | 2339 |
| 44 | Ga0316593_10034855 | 3300032168 | Bacteria | 1653 |
| 45 | Ga0316593_10059080 | 3300032168 | Bacteria | 1308 |
| 46 | Ga0316593_10078991 | 3300032168 | Bacteria | 1146 |
| 47 | Ga0316593_10081935 | 3300032168 | Bacteria | 1127 |
| 48 | Ga0316593_10098047 | 3300032168 | Bacteria | 1037 |
| 49 | Ga0316593_10135333 | 3300032168 | Bacteria | 891 |
| 50 | Ga0316593_10149908 | 3300032168 | Unclassified | 848 |
| 51 | Ga0316593_10192677 | 3300032168 | Bacteria | 752 |
| 52 | Ga0316593_10250679 | 3300032168 | Bacteria | 663 |
| 53 | Ga0316593_10426514 | 3300032168 | Bacteria | 515 |
| 54 | Ga0316592_1000022 | 3300033524 | Bacteria | 11920 |
| 55 | Ga0316592_1001266 | 3300033524 | Bacteria | 4003 |
| 56 | Ga0316592_1001616 | 3300033524 | Bacteria | 3695 |
| 57 | Ga0316592_1013540 | 3300033524 | Bacteria | 1683 |
| 58 | Ga0316592_1014897 | 3300033524 | Bacteria | 1616 |
| 59 | Ga0316592_1047520 | 3300033524 | Bacteria | 956 |
| 60 | Ga0316592_1047813 | 3300033524 | Unclassified | 953 |
| 61 | Ga0316592_1059219 | 3300033524 | Bacteria | 859 |
| 62 | Ga0316592_1080811 | 3300033524 | Bacteria | 739 |
| 63 | Ga0316586_1043313 | 3300033527 | Bacteria | 795 |
| 64 | Ga0316586_1054459 | 3300033527 | Bacteria | 720 |
| 65 | Ga0316588_1000386 | 3300033528 | Bacteria | 5801 |
| 66 | Ga0316588_1017552 | 3300033528 | Bacteria | 1596 |
| 67 | Ga0316588_1036825 | 3300033528 | Bacteria | 1162 |
| 68 | Ga0316588_1090021 | 3300033528 | Bacteria | 764 |
| 69 | Ga0316588_1091175 | 3300033528 | Bacteria | 759 |
| 70 | Ga0316588_1172208 | 3300033528 | Bacteria | 560 |
| 71 | Ga0316587_1077225 | 3300033529 | Bacteria | 627 |
| 72 | Ga0316596_1000106 | 3300033541 | Bacteria | 10634 |
| 73 | Ga0316596_1001428 | 3300033541 | Bacteria | 4810 |
| 74 | Ga0316596_1008100 | 3300033541 | Bacteria | 2498 |
| 75 | Ga0316596_1009350 | 3300033541 | Bacteria | 2351 |
| 76 | Ga0316596_1011071 | 3300033541 | Bacteria | 2196 |
| 77 | Ga0316596_1011473 | 3300033541 | Bacteria | 2166 |
| 78 | Ga0316596_1017236 | 3300033541 | Bacteria | 1815 |
| 79 | Ga0316596_1019246 | 3300033541 | Bacteria | 1732 |
| 80 | Ga0316596_1021968 | 3300033541 | Bacteria | 1629 |
| 81 | Ga0316596_1039737 | 3300033541 | Bacteria | 1234 |
| 82 | Ga0316574_0095743 | 3300035398 | Bacteria | 1897 |
| 83 | Ga0316574_0105203 | 3300035398 | Bacteria | 1807 |
| 84 | Ga0316574_0226403 | 3300035398 | Bacteria | 1197 |
| 85 | Ga0316574_0489416 | 3300035398 | Bacteria | 768 |
| 86 | Ga0316582_0032668 | 3300036647 | Bacteria | 3191 |
| 87 | Ga0316582_0158164 | 3300036647 | Bacteria | 1534 |
| 88 | Ga0316584_0015050 | 3300036712 | Bacteria | 5526 |
| 89 | Ga0316584_0107047 | 3300036712 | Bacteria | 2092 |
| 90 | Ga0400483_037503 | 3300039062 | Bacteria | 1659 |
| 91 | Ga0400489_47982 | 3300039093 | Bacteria | 6330 |
| 92 | Ga0451787_706744 | 3300041441 | Bacteria | 554 |
| 93 | Ga0451795_0161765 | 3300041456 | Bacteria | 793 |
| 94 | Ga0451795_0383055 | 3300041456 | Bacteria | 1521 |
| 95 | Ga0451837_0622082 | 3300041494 | Bacteria | 517 |
| 96 | Ga0451577_0000092 | 3300042876 | Bacteria | 198898 |
| 97 | Ga0451577_0030583 | 3300042876 | Bacteria | 4865 |
| 98 | Ga0451577_0091765 | 3300042876 | Bacteria | 2711 |
| 99 | Ga0451577_0092287 | 3300042876 | Bacteria | 2703 |
| 100 | Ga0451577_0101593 | 3300042876 | Bacteria | 2569 |
| 101 | Ga0451577_0160817 | 3300042876 | Bacteria | 2022 |
| 102 | Ga0451577_0223646 | 3300042876 | Bacteria | 1701 |
| 103 | Ga0451577_0232773 | 3300042876 | Bacteria | 1666 |
| 104 | Ga0451577_0344896 | 3300042876 | Bacteria | 1351 |
| 105 | Ga0451577_0652495 | 3300042876 | Bacteria | 954 |
| 106 | Ga0451577_1022753 | 3300042876 | Bacteria | 741 |
| 107 | Ga0451577_1025167 | 3300042876 | Bacteria | 740 |
| 108 | Ga0451577_1522163 | 3300042876 | Bacteria | 591 |
| 109 | Ga0453683_0000522 | 3300044673 | Bacteria | 43145 |
| 110 | Ga0453683_0007526 | 3300044673 | Bacteria | 7375 |
| 111 | Ga0453683_0012583 | 3300044673 | Bacteria | 5543 |
| 112 | Ga0453683_0069052 | 3300044673 | Bacteria | 2209 |
| 113 | Ga0453683_0075164 | 3300044673 | Bacteria | 2115 |
| 114 | Ga0453683_0076818 | 3300044673 | Bacteria | 2091 |
| 115 | Ga0453683_0082507 | 3300044673 | Bacteria | 2014 |
| 116 | Ga0453683_0098328 | 3300044673 | Bacteria | 1837 |
| 117 | Ga0453683_0153544 | 3300044673 | Bacteria | 1455 |
| 118 | Ga0453683_0259461 | 3300044673 | Bacteria | 1108 |
| 119 | Ga0453683_0308610 | 3300044673 | Bacteria | 1013 |
| 120 | Ga0453684_0000440 | 3300044712 | Bacteria | 169397 |
| 121 | Ga0453684_0000506 | 3300044712 | Bacteria | 152143 |
| 122 | Ga0453684_0001193 | 3300044712 | Bacteria | 80343 |
| 123 | Ga0453684_0001382 | 3300044712 | Bacteria | 70292 |
| 124 | Ga0453684_0001549 | 3300044712 | Bacteria | 64220 |
| 125 | Ga0453684_0012498 | 3300044712 | Bacteria | 13983 |
| 126 | Ga0453684_0013573 | 3300044712 | Bacteria | 13209 |
| 127 | Ga0453684_0014056 | 3300044712 | Bacteria | 12880 |
| 128 | Ga0453684_0025154 | 3300044712 | Bacteria | 8657 |
| 129 | Ga0453684_0032953 | 3300044712 | Bacteria | 7234 |
| 130 | Ga0453684_0033676 | 3300044712 | Bacteria | 7134 |
| 131 | Ga0453684_0038585 | 3300044712 | Bacteria | 6526 |
| 132 | Ga0453684_0040849 | 3300044712 | Bacteria | 6288 |
| 133 | Ga0453684_0043553 | 3300044712 | Bacteria | 6030 |
| 134 | Ga0453684_0048058 | 3300044712 | Bacteria | 5649 |
| 135 | Ga0453684_0056141 | 3300044712 | Bacteria | 5111 |
| 136 | Ga0453684_0093568 | 3300044712 | Bacteria | 3701 |
| 137 | Ga0453684_0108960 | 3300044712 | Bacteria | 3370 |
| 138 | Ga0453684_0184001 | 3300044712 | Bacteria | 2450 |
| 139 | Ga0453684_0204202 | 3300044712 | Bacteria | 2301 |
| 140 | Ga0453684_0227654 | 3300044712 | Bacteria | 2155 |
| 141 | Ga0453684_0420540 | 3300044712 | Bacteria | 1493 |
| 142 | Ga0453684_0424690 | 3300044712 | Bacteria | 1484 |
| 143 | Ga0453684_0479418 | 3300044712 | Bacteria | 1380 |
| 144 | Ga0453684_0497528 | 3300044712 | Bacteria | 1350 |
| 145 | Ga0453684_0784483 | 3300044712 | Bacteria | 1029 |
| 146 | Ga0453684_0860051 | 3300044712 | Bacteria | 974 |
| 147 | Ga0453684_1007924 | 3300044712 | Bacteria | 885 |
| 148 | Ga0453684_1078417 | 3300044712 | Bacteria | 850 |
| 149 | Ga0451576_0000113 | 3300045051 | Bacteria | 208644 |
| 150 | Ga0451576_0000204 | 3300045051 | Bacteria | 149459 |
| 151 | Ga0451576_0011813 | 3300045051 | Bacteria | 9886 |
| 152 | Ga0451576_0016217 | 3300045051 | Bacteria | 8228 |
| 153 | Ga0451576_0028432 | 3300045051 | Bacteria | 5988 |
| 154 | Ga0451576_0054946 | 3300045051 | Bacteria | 4167 |
| 155 | Ga0451576_0071147 | 3300045051 | Bacteria | 3620 |
| 156 | Ga0451576_0099290 | 3300045051 | Bacteria | 3028 |
| 157 | Ga0451576_0131889 | 3300045051 | Bacteria | 2605 |
| 158 | Ga0451576_0152881 | 3300045051 | Bacteria | 2407 |
| 159 | Ga0451576_0182356 | 3300045051 | Bacteria | 2192 |
| 160 | Ga0451576_0197917 | 3300045051 | Bacteria | 2099 |
| 161 | Ga0451576_0214571 | 3300045051 | Bacteria | 2010 |
| 162 | Ga0451576_0295252 | 3300045051 | Bacteria | 1694 |
| 163 | Ga0451576_0428461 | 3300045051 | Bacteria | 1388 |
| 164 | Ga0451576_0728955 | 3300045051 | Bacteria | 1041 |
| 165 | Ga0451576_2103365 | 3300045051 | Bacteria | 580 |
| 166 | Ga0495633_0084655 | 3300046558 | Bacteria | 1475 |
| 167 | Ga0495659_0164631 | 3300046664 | Bacteria | 897 |
| 168 | Ga0495636_0000012 | 3300047318 | Bacteria | 85270 |
| 169 | 2890807159 | 2890804823 | Bacteria | 3717572 |
| 170 | Ga0451855_0660358 | |||
| 171 | Ga0265337_1121424 | |||
| 172 | Ga0265323_10000040 | |||
| 173 | Ga0265323_10042928 | |||
| 174 | Ga0265322_10103016 | |||
| 175 | Ga0265322_10188395 | |||
| 176 | Ga0265338_10112920 | |||
| 177 | Ga0265330_10094920 | |||
| 178 | Ga0265320_10296510 | |||
| 179 | Ga0265327_10000370 | |||
| 180 | Ga0265327_10156158 | |||
| 181 | Ga0265316_10000486 | |||
| 182 | Ga0265316_10002446 | |||
| 183 | Ga0265316_10004409 | |||
| 184 | Ga0265316_10042062 | |||
| 185 | Ga0265316_10165700 | |||
| 186 | Ga0316575_10033954 | |||
| 187 | Ga0316575_10104372 | |||
| 188 | Ga0316579_10026903 | |||
| 189 | Ga0316579_10046066 | |||
| 190 | Ga0265342_10050150 | |||
| 191 | Ga0265342_10627231 | |||
| 192 | Ga0316576_10001965 | |||
| 193 | Ga0316576_10022758 | |||
| 194 | Ga0316576_10038621 | |||
| 195 | Ga0316576_10098247 | |||
| 196 | Ga0316576_10229398 | |||
| 197 | Ga0316576_10546595 | |||
| 198 | Ga0316576_10787879 | |||
| 199 | Ga0316578_10019064 | |||
| 200 | Ga0316578_10146420 | |||
| 201 | Ga0316578_10176241 | |||
| 202 | Ga0316578_10431435 | |||
| 203 | Ga0316577_10008426 | |||
| 204 | Ga0316577_10292415 | |||
| 205 | Ga0316577_10388487 | |||
| 206 | Ga0316585_10002058 | |||
| 207 | Ga0316580_10011148 | |||
| 208 | Ga0316580_10016205 | |||
| 209 | Ga0316580_10092201 | |||
| 210 | Ga0316593_10000279 | |||
| 211 | Ga0316593_10010130 | |||
| 212 | Ga0316593_10014736 | |||
| 213 | Ga0316593_10034855 | |||
| 214 | Ga0316593_10059080 | |||
| 215 | Ga0316593_10078991 | |||
| 216 | Ga0316593_10081935 | |||
| 217 | Ga0316593_10098047 | |||
| 218 | Ga0316593_10135333 | |||
| 219 | Ga0316593_10149908 | |||
| 220 | Ga0316593_10192677 | |||
| 221 | Ga0316593_10250679 | |||
| 222 | Ga0316593_10426514 | |||
| 223 | Ga0316592_1000022 | |||
| 224 | Ga0316592_1001266 | |||
| 225 | Ga0316592_1001616 | |||
| 226 | Ga0316592_1013540 | |||
| 227 | Ga0316592_1014897 | |||
| 228 | Ga0316592_1047520 | |||
| 229 | Ga0316592_1047813 | |||
| 230 | Ga0316592_1059219 | |||
| 231 | Ga0316592_1080811 | |||
| 232 | Ga0316586_1043313 | |||
| 233 | Ga0316586_1054459 | |||
| 234 | Ga0316588_1000386 | |||
| 235 | Ga0316588_1017552 | |||
| 236 | Ga0316588_1036825 | |||
| 237 | Ga0316588_1090021 | |||
| 238 | Ga0316588_1091175 | |||
| 239 | Ga0316588_1172208 | |||
| 240 | Ga0316587_1077225 | |||
| 241 | Ga0316596_1000106 | |||
| 242 | Ga0316596_1001428 | |||
| 243 | Ga0316596_1008100 | |||
| 244 | Ga0316596_1009350 | |||
| 245 | Ga0316596_1011071 | |||
| 246 | Ga0316596_1011473 | |||
| 247 | Ga0316596_1017236 | |||
| 248 | Ga0316596_1019246 | |||
| 249 | Ga0316596_1021968 | |||
| 250 | Ga0316596_1039737 | |||
| 251 | Ga0316574_0095743 | |||
| 252 | Ga0316574_0105203 | |||
| 253 | Ga0316574_0226403 | |||
| 254 | Ga0316574_0489416 | |||
| 255 | Ga0316582_0032668 | |||
| 256 | Ga0316582_0158164 | |||
| 257 | Ga0316584_0015050 | |||
| 258 | Ga0316584_0107047 | |||
| 259 | Ga0400483_037503 | |||
| 260 | Ga0400489_47982 | |||
| 261 | Ga0451787_706744 | |||
| 262 | Ga0451795_0161765 | |||
| 263 | Ga0451795_0383055 | |||
| 264 | Ga0451837_0622082 | |||
| 265 | Ga0451577_0000092 | |||
| 266 | Ga0451577_0030583 | |||
| 267 | Ga0451577_0091765 | |||
| 268 | Ga0451577_0092287 | |||
| 269 | Ga0451577_0101593 | |||
| 270 | Ga0451577_0160817 | |||
| 271 | Ga0451577_0223646 | |||
| 272 | Ga0451577_0232773 | |||
| 273 | Ga0451577_0344896 | |||
| 274 | Ga0451577_0652495 | |||
| 275 | Ga0451577_1022753 | |||
| 276 | Ga0451577_1025167 | |||
| 277 | Ga0451577_1522163 | |||
| 278 | Ga0453683_0000522 | |||
| 279 | Ga0453683_0007526 | |||
| 280 | Ga0453683_0012583 | |||
| 281 | Ga0453683_0069052 | |||
| 282 | Ga0453683_0075164 | |||
| 283 | Ga0453683_0076818 | |||
| 284 | Ga0453683_0082507 | |||
| 285 | Ga0453683_0098328 | |||
| 286 | Ga0453683_0153544 | |||
| 287 | Ga0453683_0259461 | |||
| 288 | Ga0453683_0308610 | |||
| 289 | Ga0453684_0000440 | |||
| 290 | Ga0453684_0000506 | |||
| 291 | Ga0453684_0001193 | |||
| 292 | Ga0453684_0001382 | |||
| 293 | Ga0453684_0001549 | |||
| 294 | Ga0453684_0012498 | |||
| 295 | Ga0453684_0013573 | |||
| 296 | Ga0453684_0014056 | |||
| 297 | Ga0453684_0025154 | |||
| 298 | Ga0453684_0032953 | |||
| 299 | Ga0453684_0033676 | |||
| 300 | Ga0453684_0038585 | |||
| 301 | Ga0453684_0040849 | |||
| 302 | Ga0453684_0043553 | |||
| 303 | Ga0453684_0048058 | |||
| 304 | Ga0453684_0056141 | |||
| 305 | Ga0453684_0093568 | |||
| 306 | Ga0453684_0108960 | |||
| 307 | Ga0453684_0184001 | |||
| 308 | Ga0453684_0204202 | |||
| 309 | Ga0453684_0227654 | |||
| 310 | Ga0453684_0420540 | |||
| 311 | Ga0453684_0424690 | |||
| 312 | Ga0453684_0479418 | |||
| 313 | Ga0453684_0497528 | |||
| 314 | Ga0453684_0784483 | |||
| 315 | Ga0453684_0860051 | |||
| 316 | Ga0453684_1007924 | |||
| 317 | Ga0453684_1078417 | |||
| 318 | Ga0451576_0000113 | |||
| 319 | Ga0451576_0000204 | |||
| 320 | Ga0451576_0011813 | |||
| 321 | Ga0451576_0016217 | |||
| 322 | Ga0451576_0028432 | |||
| 323 | Ga0451576_0054946 | |||
| 324 | Ga0451576_0071147 | |||
| 325 | Ga0451576_0099290 | |||
| 326 | Ga0451576_0131889 | |||
| 327 | Ga0451576_0152881 | |||
| 328 | Ga0451576_0182356 | |||
| 329 | Ga0451576_0197917 | |||
| 330 | Ga0451576_0214571 | |||
| 331 | Ga0451576_0295252 | |||
| 332 | Ga0451576_0428461 | |||
| 333 | Ga0451576_0728955 | |||
| 334 | Ga0451576_2103365 | |||
| 335 | Ga0495633_0084655 | |||
| 336 | Ga0495659_0164631 | |||
| 337 | Ga0495636_0000012 | |||
| 338 | 2890807159 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8c9c-assembly1.cif.gz_S | cryo-em captures early ribosome assembly in action | 0.903 | 19 | 128 |
| 8c9a-assembly1.cif.gz_S | cryo-em captures early ribosome assembly in action | 0.8898 | 21 | 128 |
| 8c97-assembly1.cif.gz_S | cryo-em captures early ribosome assembly in action | 0.888 | 19 | 128 |
| 8c95-assembly1.cif.gz_S | cryo-em captures early ribosome assembly in action | 0.8732 | 19 | 128 |
| 8c9c-assembly1.cif.gz_S | cryo-em captures early ribosome assembly in action | 0.8662 | 19 | 128 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9ZU27_109_252_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.8663 | 46 | 73 | 1.25.40.10 |
| af_A0A0P0YAA5_35_146_3.90.470.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 | 0.8016 | 19 | 130 | 3.90.470.10 |
| af_Q4CXM4_1288_1928_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.7984 | 46 | 77 | 1.25.10.10 |
| af_Q60375_1_181_1.20.120.160 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain | 0.7812 | 46 | 86 | 1.20.120.160 |
| af_I1K1P2_86_208_3.90.470.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;Ribosomal protein L22/L17 | 0.7744 | 19 | 129 | 3.90.470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5D0H3K6-F1-model_v4 | 50S ribosomal protein L22 | 0.9514 | 9 | 93 |
GO:0003735
GO:0006412 GO:0019843 GO:0022625 |
| AF-A0A2N3AJW7-F1-model_v4 | 50S ribosomal protein L22 | 0.9331 | 21 | 129 |
GO:0003735
GO:0006412 GO:0019843 GO:0022625 |
| AF-A0A2A6E4U7-F1-model_v4 | 50S ribosomal protein L22 | 0.9325 | 1 | 100 |
GO:0003735
GO:0006412 GO:0019843 GO:0022625 |
| AF-A0A519TI66-F1-model_v4 | 50S ribosomal protein L22 | 0.9247 | 22 | 104 |
GO:0003735
GO:0006412 GO:0019843 GO:0022625 |
| AF-A0A5D0H3K6-F1-model_v4 | 50S ribosomal protein L22 | 0.9203 | 9 | 93 |
GO:0003735
GO:0006412 GO:0019843 GO:0022625 |