F254574

General Info

Members Datasets Scaffolds Average Seq Length
169 125 338 62

Family's Representative Sequence

Representative Sequence 3300007076|Ga0075435_100614826|Ga0075435_1006148262
Length 73
Sequence MSRADREHEDERRLSDEASYTCGSCGEEIVVPIDASAGDHQQYVEDCPVCCSPNVVFVDLDEDGSARVTSEPE

Samples

Sample ID Description Type Environment
1 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
6 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
10 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
11 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
12 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
13 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
14 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
15 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
19 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
30 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
31 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
38 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
39 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
40 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
52 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
53 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
54 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
55 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
56 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
57 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
58 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
59 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
60 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
61 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
62 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
63 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
64 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
65 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
66 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
67 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
68 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
69 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
70 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
71 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
72 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
73 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
74 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
75 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
76 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
77 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
78 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
79 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
80 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
81 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
82 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
83 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
84 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
85 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
86 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
87 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
88 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
89 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
90 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
91 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
92 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
93 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
94 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
95 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
96 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
97 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
98 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
99 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
107 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
108 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
109 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
110 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
111 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
112 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
113 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
116 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
117 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
118 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
119 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
120 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
121 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
122 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
123 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
124 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
125 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.41
Metatranscriptomes 0.59
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.59
Nodule 0
Rhizoplane 5.33
Rhizosphere 86.39
Stem 0
Stem Tuber 0
Unclassified 38.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075435_100614826 3300007076 Bacteria 943
2 Ga0065704_10114993 3300005289 Bacteria 1880
3 Ga0070670_100195894 3300005331 Bacteria 1755
4 Ga0070689_102117374 3300005340 Bacteria 515
5 Ga0070705_101307730 3300005440 Unclassified 601
6 Ga0070678_101619130 3300005456 Unclassified 608
7 Ga0070681_11532493 3300005458 Bacteria 591
8 Ga0070698_100164015 3300005471 Bacteria 2165
9 Ga0070698_100889313 3300005471 Unclassified 836
10 Ga0070695_100976029 3300005545 Bacteria 688
11 Ga0070693_100241102 3300005547 Unclassified 1194
12 Ga0068852_101076162 3300005616 Unclassified 824
13 Ga0068864_101083664 3300005618 Unclassified 797
14 Ga0068861_100703301 3300005719 Bacteria 939
15 Ga0068863_100644928 3300005841 Bacteria 1050
16 Ga0068858_100976037 3300005842 Bacteria 830
17 Ga0068860_100344692 3300005843 Bacteria 1465
18 Ga0070717_10817494 3300006028 Bacteria 848
19 Ga0075367_10463203 3300006178 Bacteria 804
20 Ga0097621_100502463 3300006237 Bacteria 1098
21 Ga0075428_100351979 3300006844 Bacteria 1581
22 Ga0075430_100645055 3300006846 Bacteria 873
23 Ga0075431_100162501 3300006847 Bacteria 2296
24 Ga0075431_101064897 3300006847 Unclassified 774
25 Ga0105247_10462127 3300009101 Unclassified 917
26 Ga0114129_11715823 3300009147 Unclassified 766
27 Ga0105243_11015307 3300009148 Unclassified 833
28 Ga0105243_12580812 3300009148 Unclassified 548
29 Ga0105248_11159019 3300009177 Bacteria 874
30 Ga0105248_12517195 3300009177 Bacteria 587
31 Ga0105248_12690124 3300009177 Bacteria 567
32 Ga0105238_11151531 3300009551 Bacteria 799
33 Ga0105249_12382702 3300009553 Unclassified 602
34 Ga0105249_13448201 3300009553 Bacteria 509
35 Ga0105246_12043037 3300011119 Bacteria 554
36 Ga0157374_11385746 3300013296 Unclassified 726
37 Ga0157378_11734287 3300013297 Bacteria 672
38 Ga0163162_11349791 3300013306 Unclassified 811
39 Ga0163162_12189066 3300013306 Unclassified 635
40 Ga0157372_12793874 3300013307 Unclassified 560
41 Ga0163163_10957845 3300014325 Bacteria 919
42 Ga0163163_11657593 3300014325 Unclassified 700
43 Ga0157379_11325447 3300014968 Unclassified 696
44 Ga0157376_12984315 3300014969 Unclassified 512
45 Ga0213874_10403013 3300021377 Bacteria 533
46 Ga0213876_10684154 3300021384 Bacteria 546
47 Ga0213875_10224535 3300021388 Bacteria 885
48 Ga0213875_10243166 3300021388 Bacteria 848
49 Ga0207707_10438974 3300025912 Bacteria 1118
50 Ga0207694_10311176 3300025924 Bacteria 1298
51 Ga0207700_10478015 3300025928 Bacteria 1101
52 Ga0207709_10912546 3300025935 Unclassified 714
53 Ga0207711_11324495 3300025941 Bacteria 662
54 Ga0207678_11037042 3300026067 Bacteria 726
55 Ga0207678_11554013 3300026067 Bacteria 583
56 Ga0207702_12365626 3300026078 Bacteria 519
57 Ga0207641_10384962 3300026088 Bacteria 1344
58 Ga0207641_11634157 3300026088 Bacteria 646
59 Ga0207676_11095799 3300026095 Bacteria 787
60 Ga0207676_11963553 3300026095 Unclassified 584
61 Ga0207674_11141054 3300026116 Bacteria 749
62 Ga0268264_11752592 3300028381 Bacteria 631
63 Ga0265338_10016047 3300028800 Bacteria 8180
64 Ga0265338_10071171 3300028800 Bacteria 2977
65 Ga0265338_10203574 3300028800 Bacteria 1491
66 Ga0265324_10153524 3300029957 Bacteria 782
67 Ga0265760_10007949 3300031090 Bacteria 3030
68 Ga0265325_10000204 3300031241 Bacteria 42066
69 Ga0265325_10032744 3300031241 Unclassified 2773
70 Ga0265340_10356421 3300031247 Bacteria 646
71 Ga0265339_10000619 3300031249 Bacteria 27549
72 Ga0265339_10077471 3300031249 Bacteria 1762
73 Ga0265331_10000427 3300031250 Bacteria 42238
74 Ga0265331_10120054 3300031250 Bacteria 1202
75 Ga0265313_10000821 3300031595 Bacteria 31354
76 Ga0265314_10001445 3300031711 Bacteria 26553
77 Ga0265314_10183011 3300031711 Unclassified 1253
78 Ga0265342_10060010 3300031712 Bacteria 2244
79 Ga0373933_0729269 3300035724 Unclassified 652
80 Ga0373947_0426981 3300035725 Unclassified 896
81 Ga0373925_0972358 3300037068 Unclassified 699
82 Ga0436364_0785590 3300037853 Unclassified 642
83 Ga0436364_1267616 3300037853 Bacteria 1666
84 Ga0436364_1276189 3300037853 Bacteria 853
85 Ga0436365_0636385 3300039437 Bacteria 654
86 Ga0436365_1006309 3300039437 Bacteria 1035
87 Ga0436360_0027235 3300039438 Bacteria 531
88 Ga0436360_1001216 3300039438 Bacteria 519
89 Ga0436363_0048881 3300039450 Bacteria 717
90 Ga0436363_0349465 3300039450 Bacteria 709
91 Ga0436362_0779731 3300039453 Bacteria 769
92 Ga0436362_0873671 3300039453 Bacteria 656
93 Ga0451795_1315283 3300041456 Bacteria 550
94 Ga0451798_0814062 3300041458 Bacteria 778
95 Ga0451851_1281744 3300041507 Bacteria 534
96 Ga0451853_2917859 3300041512 Unclassified 545
97 Ga0450923_134608 3300042125 Bacteria 590
98 Ga0466967_2211494 3300045976 Bacteria 546
99 Ga0495592_0222378 3300046454 Bacteria 1262
100 Ga0495662_0174219 3300046476 Unclassified 1060
101 Ga0495594_0812630 3300046499 Unclassified 527
102 Ga0495608_0020341 3300046511 Bacteria 4561
103 Ga0495628_0025263 3300046516 Bacteria 4854
104 Ga0495628_0245140 3300046516 Unclassified 1339
105 Ga0495630_0641170 3300046517 Unclassified 814
106 Ga0495665_0664219 3300046531 Unclassified 518
107 Ga0495586_0145872 3300046535 Unclassified 1330
108 Ga0495586_0403028 3300046535 Bacteria 787
109 Ga0495667_0001138 3300046559 Bacteria 17330
110 Ga0495634_0204963 3300046642 Unclassified 1223
111 Ga0495635_0850782 3300046663 Unclassified 586
112 Ga0495659_0263339 3300046664 Bacteria 721
113 Ga0495599_0533916 3300046678 Bacteria 688
114 Ga0495599_0867843 3300046678 Bacteria 513
115 Ga0495624_0868314 3300046690 Unclassified 532
116 Ga0495604_0276399 3300047317 Unclassified 1136
117 Ga0495636_0003480 3300047318 Bacteria 6114
118 Ga0495674_0161457 3300047319 Bacteria 1875
119 Ga0495680_0348680 3300047322 Unclassified 1031
120 Ga0495684_0113225 3300047471 Unclassified 2046
121 Ga0495684_0516586 3300047471 Unclassified 819
122 Ga0495684_0558507 3300047471 Bacteria 778
123 Ga0495602_0996903 3300048088 Unclassified 553
124 Ga0496100_0816120 3300048903 Unclassified 731
125 Ga0496102_1825835 3300048905 Unclassified 525
126 Ga0496104_0306331 3300048907 Bacteria 1501
127 Ga0496104_0446582 3300048907 Bacteria 1205
128 Ga0496104_1010104 3300048907 Unclassified 736
129 Ga0496108_0811911 3300048911 Unclassified 807
130 Ga0496108_1655371 3300048911 Unclassified 528
131 Ga0501031_0314633 3300049568 Bacteria 1014
132 Ga0501034_0058596 3300049571 Bacteria 3870
133 Ga0501034_0307377 3300049571 Bacteria 1521
134 Ga0501039_0153668 3300049575 Unclassified 1808
135 Ga0501039_1288891 3300049575 Unclassified 564
136 Ga0501040_0157586 3300049576 Unclassified 1604
137 Ga0501042_0245200 3300049578 Bacteria 1293
138 Ga0501042_0422450 3300049578 Unclassified 966
139 Ga0501042_0477426 3300049578 Unclassified 905
140 Ga0501046_0008769 3300049580 Bacteria 8783
141 Ga0501048_0099376 3300049582 Unclassified 2053
142 Ga0501048_0264815 3300049582 Bacteria 1221
143 Ga0501069_0671137 3300049585 Unclassified 624
144 Ga0501070_0000411 3300049586 Bacteria 38984
145 Ga0501071_0074579 3300049587 Unclassified 2476
146 Ga0501072_0333891 3300049588 Unclassified 1204
147 Ga0501076_0489662 3300049592 Unclassified 1013
148 Ga0501076_1083139 3300049592 Bacteria 660
149 Ga0501076_1682898 3300049592 Bacteria 520
150 Ga0501076_1811907 3300049592 Bacteria 500
151 Ga0501080_0747407 3300049742 Bacteria 860
152 Ga0501081_0179344 3300049743 Unclassified 1532
153 Ga0501083_0672387 3300049744 Bacteria 673
154 Ga0501083_0745217 3300049744 Unclassified 637
155 Ga0501044_0028027 3300049823 Bacteria 5944
156 Ga0501044_0810963 3300049823 Unclassified 815
157 Ga0501045_0130217 3300049824 Unclassified 1870
158 Ga0501045_0734236 3300049824 Unclassified 728
159 nmdc:mga09592_1202689_c1 3300050508 Bacteria 626
160 nmdc:mga06r32_149453_c1 3300050510 Bacteria 2314
161 nmdc:mga06r32_290207_c1 3300050510 Bacteria 1622
162 nmdc:mga08y16_1251232_c1 3300050511 Bacteria 711
163 nmdc:mga0n895_976365_c1 3300050512 Bacteria 829
164 nmdc:mga0rr50_357882_c1 3300050513 Bacteria 1228
165 Ga0495601_0442731 3300053077 Bacteria 841
166 Ga0495595_0101431 3300053084 Unclassified 1390
167 Ga0495619_0923768 3300053085 Unclassified 586
168 Ga0501082_1292637 3300060353 Unclassified 637
169 Ga0530510_0772598 3300061734 Bacteria 733
170 Ga0075435_100614826
171 Ga0065704_10114993
172 Ga0070670_100195894
173 Ga0070689_102117374
174 Ga0070705_101307730
175 Ga0070678_101619130
176 Ga0070681_11532493
177 Ga0070698_100164015
178 Ga0070698_100889313
179 Ga0070695_100976029
180 Ga0070693_100241102
181 Ga0068852_101076162
182 Ga0068864_101083664
183 Ga0068861_100703301
184 Ga0068863_100644928
185 Ga0068858_100976037
186 Ga0068860_100344692
187 Ga0070717_10817494
188 Ga0075367_10463203
189 Ga0097621_100502463
190 Ga0075428_100351979
191 Ga0075430_100645055
192 Ga0075431_100162501
193 Ga0075431_101064897
194 Ga0105247_10462127
195 Ga0114129_11715823
196 Ga0105243_11015307
197 Ga0105243_12580812
198 Ga0105248_11159019
199 Ga0105248_12517195
200 Ga0105248_12690124
201 Ga0105238_11151531
202 Ga0105249_12382702
203 Ga0105249_13448201
204 Ga0105246_12043037
205 Ga0157374_11385746
206 Ga0157378_11734287
207 Ga0163162_11349791
208 Ga0163162_12189066
209 Ga0157372_12793874
210 Ga0163163_10957845
211 Ga0163163_11657593
212 Ga0157379_11325447
213 Ga0157376_12984315
214 Ga0213874_10403013
215 Ga0213876_10684154
216 Ga0213875_10224535
217 Ga0213875_10243166
218 Ga0207707_10438974
219 Ga0207694_10311176
220 Ga0207700_10478015
221 Ga0207709_10912546
222 Ga0207711_11324495
223 Ga0207678_11037042
224 Ga0207678_11554013
225 Ga0207702_12365626
226 Ga0207641_10384962
227 Ga0207641_11634157
228 Ga0207676_11095799
229 Ga0207676_11963553
230 Ga0207674_11141054
231 Ga0268264_11752592
232 Ga0265338_10016047
233 Ga0265338_10071171
234 Ga0265338_10203574
235 Ga0265324_10153524
236 Ga0265760_10007949
237 Ga0265325_10000204
238 Ga0265325_10032744
239 Ga0265340_10356421
240 Ga0265339_10000619
241 Ga0265339_10077471
242 Ga0265331_10000427
243 Ga0265331_10120054
244 Ga0265313_10000821
245 Ga0265314_10001445
246 Ga0265314_10183011
247 Ga0265342_10060010
248 Ga0373933_0729269
249 Ga0373947_0426981
250 Ga0373925_0972358
251 Ga0436364_0785590
252 Ga0436364_1267616
253 Ga0436364_1276189
254 Ga0436365_0636385
255 Ga0436365_1006309
256 Ga0436360_0027235
257 Ga0436360_1001216
258 Ga0436363_0048881
259 Ga0436363_0349465
260 Ga0436362_0779731
261 Ga0436362_0873671
262 Ga0451795_1315283
263 Ga0451798_0814062
264 Ga0451851_1281744
265 Ga0451853_2917859
266 Ga0450923_134608
267 Ga0466967_2211494
268 Ga0495592_0222378
269 Ga0495662_0174219
270 Ga0495594_0812630
271 Ga0495608_0020341
272 Ga0495628_0025263
273 Ga0495628_0245140
274 Ga0495630_0641170
275 Ga0495665_0664219
276 Ga0495586_0145872
277 Ga0495586_0403028
278 Ga0495667_0001138
279 Ga0495634_0204963
280 Ga0495635_0850782
281 Ga0495659_0263339
282 Ga0495599_0533916
283 Ga0495599_0867843
284 Ga0495624_0868314
285 Ga0495604_0276399
286 Ga0495636_0003480
287 Ga0495674_0161457
288 Ga0495680_0348680
289 Ga0495684_0113225
290 Ga0495684_0516586
291 Ga0495684_0558507
292 Ga0495602_0996903
293 Ga0496100_0816120
294 Ga0496102_1825835
295 Ga0496104_0306331
296 Ga0496104_0446582
297 Ga0496104_1010104
298 Ga0496108_0811911
299 Ga0496108_1655371
300 Ga0501031_0314633
301 Ga0501034_0058596
302 Ga0501034_0307377
303 Ga0501039_0153668
304 Ga0501039_1288891
305 Ga0501040_0157586
306 Ga0501042_0245200
307 Ga0501042_0422450
308 Ga0501042_0477426
309 Ga0501046_0008769
310 Ga0501048_0099376
311 Ga0501048_0264815
312 Ga0501069_0671137
313 Ga0501070_0000411
314 Ga0501071_0074579
315 Ga0501072_0333891
316 Ga0501076_0489662
317 Ga0501076_1083139
318 Ga0501076_1682898
319 Ga0501076_1811907
320 Ga0501080_0747407
321 Ga0501081_0179344
322 Ga0501083_0672387
323 Ga0501083_0745217
324 Ga0501044_0028027
325 Ga0501044_0810963
326 Ga0501045_0130217
327 Ga0501045_0734236
328 nmdc:mga09592_1202689_c1
329 nmdc:mga06r32_149453_c1
330 nmdc:mga06r32_290207_c1
331 nmdc:mga08y16_1251232_c1
332 nmdc:mga0n895_976365_c1
333 nmdc:mga0rr50_357882_c1
334 Ga0495601_0442731
335 Ga0495595_0101431
336 Ga0495619_0923768
337 Ga0501082_1292637
338 Ga0530510_0772598

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14255

Cys_rich_CPXG

Cysteine-rich CPXCG

20

71

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vi9-assembly1.cif.gz_A crystal structure of protein kinase a in complex with the pki peptide and aminobenzothiazole based inhibitors 0.8005 29 50
7q3d-assembly1.cif.gz_C structure of the human cplane complex 0.7534 29 65
8avg-assembly1.cif.gz_A cryo-em structure of mouse elp123 with bound sam 0.7279 30 63
6e09-assembly2.cif.gz_C crystal structure of helicobacter pylori tlpa chemoreceptor ligand binding domain 0.7231 26 50
6e09-assembly1.cif.gz_A crystal structure of helicobacter pylori tlpa chemoreceptor ligand binding domain 0.7136 26 50
ID Description Score Start End Superfamily
af_A4I347_14_125_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.8272 30 50 3.30.200.20
af_Q4DQ16_48_144_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.8201 29 54 3.30.200.20
af_A4HZB4_16_93_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.8103 29 53 3.30.200.20
af_Q8I629_83_345_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.8078 29 50 1.10.510.10
5vi9A02 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.8005 29 50 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A5B9PRW2-F1-model_v4 CPXCG motif-containing cysteine-rich protein 0.9789 8 62
AF-A0A2E3RIY7-F1-model_v4 CPXCG motif-containing cysteine-rich protein 0.9774 7 64
AF-A0A177R1L6-F1-model_v4 deleted 0.976 8 64
AF-A0A3C1YPM0-F1-model_v4 CPXCG motif-containing cysteine-rich protein 0.9738 8 64
AF-A0A5C5YT73-F1-model_v4 CPXCG motif-containing cysteine-rich protein 0.965 6 64

Map