F254466

General Info

Members Datasets Scaffolds Average Seq Length
169 95 338 150

Family's Representative Sequence

Representative Sequence 3300006042|Ga0075368_10080045|Ga0075368_100800452
Length 148
Sequence MTQKIDVLVVDDDPDYCELAVAALKACGQRHVLCLHDGTDAIDYLRGANRFSGRDVRAQPRLVLLDLKLVRMHGLEVLRAMRADAAARDVPVVVMSATDDQKSLRECYEAGANSVVRKTVDYTELTRKLKGIFEFWLNINEQNHESRV

Samples

Sample ID Description Type Environment
1 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
14 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
15 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
18 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
19 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
20 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
23 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
24 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
25 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
31 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
32 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
33 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
48 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
49 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
50 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
51 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
52 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
53 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
54 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
55 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
56 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
57 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
58 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
59 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
60 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
61 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
62 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
63 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
64 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
65 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
66 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
67 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
68 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
69 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
70 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
71 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
72 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
73 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
74 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
75 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
76 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
77 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
78 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
79 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
80 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
81 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
86 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
87 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
88 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
90 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
91 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
92 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
93 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
94 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
95 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.65
Nodule 0
Rhizoplane 0.59
Rhizosphere 86.98
Stem 0
Stem Tuber 0
Unclassified 2.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075368_10080045 3300006042 Bacteria 1329
2 Ga0070658_10244410 3300005327 Bacteria 1522
3 Ga0068869_100408639 3300005334 Bacteria 1118
4 Ga0068869_100545859 3300005334 Bacteria 973
5 Ga0068868_100011962 3300005338 Bacteria 6332
6 Ga0068868_100045825 3300005338 Bacteria 3422
7 Ga0070660_100183158 3300005339 Bacteria 1695
8 Ga0070660_100658474 3300005339 Bacteria 877
9 Ga0070691_10090439 3300005341 Bacteria 1508
10 Ga0070659_100521339 3300005366 Bacteria 1015
11 Ga0070681_10333552 3300005458 Bacteria 1426
12 Ga0070679_100068812 3300005530 Bacteria 3531
13 Ga0070679_100334423 3300005530 Bacteria 1463
14 Ga0068853_100445114 3300005539 Bacteria 1218
15 Ga0068855_100016913 3300005563 Bacteria 8770
16 Ga0068855_100247167 3300005563 Bacteria 1991
17 Ga0068855_100284561 3300005563 Bacteria 1835
18 Ga0068856_100075445 3300005614 Bacteria 3340
19 Ga0068864_101522043 3300005618 Bacteria 672
20 Ga0068863_100347744 3300005841 Bacteria 1443
21 Ga0068863_100692267 3300005841 Bacteria 1013
22 Ga0075365_10017990 3300006038 Bacteria 4337
23 Ga0075363_100080566 3300006048 Bacteria 1781
24 Ga0075363_100164725 3300006048 Bacteria 1256
25 Ga0075362_10017193 3300006177 Bacteria 2976
26 Ga0075362_10238371 3300006177 Bacteria 892
27 Ga0075367_10007148 3300006178 Bacteria 5696
28 Ga0075366_10080293 3300006195 Bacteria 1948
29 Ga0075370_10112739 3300006353 Bacteria 1580
30 Ga0075370_10304072 3300006353 Bacteria 949
31 Ga0105240_10329132 3300009093 Bacteria 1739
32 Ga0105240_11370789 3300009093 Bacteria 744
33 Ga0105245_10019190 3300009098 Bacteria 5988
34 Ga0105241_10289070 3300009174 Bacteria 1403
35 Ga0105242_10747395 3300009176 Bacteria 962
36 Ga0105248_10112868 3300009177 Bacteria 3065
37 Ga0105237_11110845 3300009545 Bacteria 797
38 Ga0105238_10142445 3300009551 Bacteria 2374
39 Ga0105239_10119370 3300010375 Bacteria 2927
40 Ga0105239_10666669 3300010375 Bacteria 1188
41 Ga0157369_11610696 3300013105 Bacteria 660
42 Ga0157378_10231359 3300013297 Bacteria 1761
43 Ga0157378_10363618 3300013297 Bacteria 1417
44 Ga0182008_10124321 3300014497 Bacteria 1283
45 Ga0182008_10243082 3300014497 Bacteria 926
46 Ga0182008_10862141 3300014497 Unclassified 530
47 Ga0157376_10005103 3300014969 Bacteria 9150
48 Ga0157376_10007496 3300014969 Bacteria 7795
49 Ga0157376_10746832 3300014969 Bacteria 987
50 Ga0207705_10275088 3300025909 Bacteria 1288
51 Ga0207657_10018451 3300025919 Bacteria 6659
52 Ga0207657_10306346 3300025919 Bacteria 1258
53 Ga0207652_10016834 3300025921 Bacteria 5975
54 Ga0207652_10186610 3300025921 Bacteria 1865
55 Ga0207694_10052317 3300025924 Bacteria 3166
56 Ga0207694_11455048 3300025924 Unclassified 579
57 Ga0207650_10137540 3300025925 Bacteria 1918
58 Ga0207687_10769142 3300025927 Bacteria 820
59 Ga0207690_11325691 3300025932 Bacteria 602
60 Ga0207689_10375138 3300025942 Bacteria 1184
61 Ga0207689_10397567 3300025942 Bacteria 1149
62 Ga0207667_10428603 3300025949 Bacteria 1345
63 Ga0207677_10003360 3300026023 Bacteria 8476
64 Ga0207677_10005963 3300026023 Bacteria 6634
65 Ga0207639_10377679 3300026041 Bacteria 1272
66 Ga0207702_10495906 3300026078 Bacteria 1190
67 Ga0207641_10497405 3300026088 Bacteria 1183
68 Ga0207674_10980603 3300026116 Bacteria 814
69 Ga0307410_10884824 3300031852 Bacteria 764
70 Ga0307416_101857875 3300032002 Bacteria 706
71 Ga0395899_0008411 3300037312 Bacteria 7945
72 Ga0395899_0058024 3300037312 Bacteria 2856
73 Ga0395899_0202927 3300037312 Bacteria 1381
74 Ga0395900_0017765 3300037418 Bacteria 7260
75 Ga0395900_0057803 3300037418 Bacteria 3993
76 Ga0395900_0231241 3300037418 Bacteria 1859
77 Ga0395900_0559004 3300037418 Bacteria 1088
78 Ga0395900_0592434 3300037418 Bacteria 1050
79 Ga0395900_0694903 3300037418 Bacteria 951
80 Ga0395900_0797841 3300037418 Bacteria 872
81 Ga0395898_0013144 3300037466 Bacteria 8533
82 Ga0395898_0025710 3300037466 Bacteria 5929
83 Ga0395898_0027894 3300037466 Bacteria 5662
84 Ga0395905_0000065 3300037471 Bacteria 184928
85 Ga0395905_0000712 3300037471 Bacteria 43953
86 Ga0395905_0001008 3300037471 Bacteria 35984
87 Ga0395905_0004994 3300037471 Bacteria 13671
88 Ga0395905_0029328 3300037471 Bacteria 5184
89 Ga0395905_0060975 3300037471 Bacteria 3527
90 Ga0395905_0094357 3300037471 Bacteria 2807
91 Ga0395905_0117392 3300037471 Bacteria 2500
92 Ga0395905_0132594 3300037471 Bacteria 2343
93 Ga0395905_0152532 3300037471 Bacteria 2173
94 Ga0395905_0212529 3300037471 Bacteria 1812
95 Ga0395905_0485856 3300037471 Bacteria 1134
96 Ga0395905_0769646 3300037471 Bacteria 865
97 Ga0395905_0917592 3300037471 Bacteria 779
98 Ga0395905_1025974 3300037471 Bacteria 728
99 Ga0395905_1434322 3300037471 Bacteria 594
100 Ga0395901_0063856 3300038443 Bacteria 3833
101 Ga0395901_0066320 3300038443 Bacteria 3760
102 Ga0395901_0125144 3300038443 Bacteria 2701
103 Ga0395901_0125942 3300038443 Bacteria 2692
104 Ga0395901_0126887 3300038443 Bacteria 2681
105 Ga0395901_0163006 3300038443 Bacteria 2341
106 Ga0395901_0166883 3300038443 Bacteria 2311
107 Ga0395901_0231255 3300038443 Bacteria 1930
108 Ga0395901_0289456 3300038443 Bacteria 1700
109 Ga0395901_0317045 3300038443 Bacteria 1614
110 Ga0395901_0426014 3300038443 Unclassified 1360
111 Ga0395901_0520417 3300038443 Bacteria 1208
112 Ga0436365_1197994 3300039437 Bacteria 635
113 Ga0439439_0007053 3300041406 Bacteria 2619
114 Ga0439447_106654 3300041407 Unclassified 643
115 Ga0451807_0510689 3300041486 Bacteria 743
116 Ga0451845_0456214 3300041501 Bacteria 609
117 Ga0451843_1379923 3300041509 Bacteria 634
118 Ga0439431_0073053 3300041997 Bacteria 916
119 Ga0439433_0005302 3300041999 Bacteria 2770
120 Ga0439433_0023788 3300041999 Bacteria 1379
121 Ga0439449_0000980 3300042007 Bacteria 11230
122 Ga0439449_0007705 3300042007 Bacteria 4087
123 Ga0439449_0029298 3300042007 Bacteria 2051
124 Ga0439457_062298 3300042014 Bacteria 845
125 Ga0439462_0002628 3300042015 Bacteria 4204
126 Ga0450912_008021 3300042116 Bacteria 868
127 Ga0450914_013113 3300042118 Bacteria 840
128 Ga0450905_026109 3300042142 Bacteria 882
129 Ga0450916_014494 3300042530 Bacteria 1027
130 Ga0450893_0000252 3300042532 Bacteria 7239
131 Ga0450893_0002220 3300042532 Bacteria 3023
132 Ga0451577_1157106 3300042876 Bacteria 691
133 Ga0451577_1609886 3300042876 Unclassified 573
134 Ga0466969_0006408 3300044656 Bacteria 6265
135 Ga0466969_0013252 3300044656 Bacteria 4342
136 Ga0466969_0151461 3300044656 Bacteria 1068
137 Ga0466972_0213218 3300044658 Bacteria 903
138 Ga0466966_0001562 3300044684 Bacteria 14708
139 Ga0466966_0204836 3300044684 Bacteria 1193
140 Ga0466961_0004360 3300044693 Bacteria 8865
141 Ga0466961_0017030 3300044693 Bacteria 4667
142 Ga0466961_0133847 3300044693 Bacteria 1553
143 Ga0466961_0289407 3300044693 Bacteria 1002
144 Ga0466968_0013022 3300044735 Bacteria 3265
145 Ga0466957_0049117 3300044842 Bacteria 2565
146 Ga0466957_0142068 3300044842 Bacteria 1547
147 Ga0466960_0053971 3300044901 Bacteria 1949
148 Ga0466959_0003021 3300045049 Bacteria 10871
149 Ga0466959_0042886 3300045049 Bacteria 3336
150 Ga0451576_1535581 3300045051 Bacteria 691
151 Ga0495636_0379634 3300047318 Bacteria 671
152 Ga0501031_0476727 3300049568 Bacteria 805
153 Ga0501043_0031313 3300049579 Bacteria 4182
154 Ga0501046_0167471 3300049580 Bacteria 1650
155 Ga0501047_0128501 3300049581 Bacteria 2414
156 Ga0501206_048488 3300049653 Bacteria 671
157 Ga0501080_0166544 3300049742 Bacteria 2033
158 Ga0501264_027834 3300049761 Bacteria 636
159 Ga0501035_0073544 3300049822 Bacteria 3024
160 Ga0501044_0227238 3300049823 Bacteria 1815
161 nmdc:mga03n38_183114_c1 3300050490 Bacteria 1074
162 nmdc:mga0yw44_11725_c1 3300050492 Bacteria 4541
163 nmdc:mga0yw44_593751_c1 3300050492 Bacteria 752
164 nmdc:mga0yw44_93655_c2 3300050492 Bacteria 1546
165 nmdc:mga0k408_52781_c1 3300050493 Bacteria 2356
166 nmdc:mga0k408_93592_c1 3300050493 Bacteria 1767
167 nmdc:mga06z11_534787_c1 3300050494 Bacteria 711
168 nmdc:mga07m45_230285_c1 3300050496 Bacteria 1078
169 Ga0466962_0228668 3300061719 Bacteria 912
170 Ga0075368_10080045
171 Ga0070658_10244410
172 Ga0068869_100408639
173 Ga0068869_100545859
174 Ga0068868_100011962
175 Ga0068868_100045825
176 Ga0070660_100183158
177 Ga0070660_100658474
178 Ga0070691_10090439
179 Ga0070659_100521339
180 Ga0070681_10333552
181 Ga0070679_100068812
182 Ga0070679_100334423
183 Ga0068853_100445114
184 Ga0068855_100016913
185 Ga0068855_100247167
186 Ga0068855_100284561
187 Ga0068856_100075445
188 Ga0068864_101522043
189 Ga0068863_100347744
190 Ga0068863_100692267
191 Ga0075365_10017990
192 Ga0075363_100080566
193 Ga0075363_100164725
194 Ga0075362_10017193
195 Ga0075362_10238371
196 Ga0075367_10007148
197 Ga0075366_10080293
198 Ga0075370_10112739
199 Ga0075370_10304072
200 Ga0105240_10329132
201 Ga0105240_11370789
202 Ga0105245_10019190
203 Ga0105241_10289070
204 Ga0105242_10747395
205 Ga0105248_10112868
206 Ga0105237_11110845
207 Ga0105238_10142445
208 Ga0105239_10119370
209 Ga0105239_10666669
210 Ga0157369_11610696
211 Ga0157378_10231359
212 Ga0157378_10363618
213 Ga0182008_10124321
214 Ga0182008_10243082
215 Ga0182008_10862141
216 Ga0157376_10005103
217 Ga0157376_10007496
218 Ga0157376_10746832
219 Ga0207705_10275088
220 Ga0207657_10018451
221 Ga0207657_10306346
222 Ga0207652_10016834
223 Ga0207652_10186610
224 Ga0207694_10052317
225 Ga0207694_11455048
226 Ga0207650_10137540
227 Ga0207687_10769142
228 Ga0207690_11325691
229 Ga0207689_10375138
230 Ga0207689_10397567
231 Ga0207667_10428603
232 Ga0207677_10003360
233 Ga0207677_10005963
234 Ga0207639_10377679
235 Ga0207702_10495906
236 Ga0207641_10497405
237 Ga0207674_10980603
238 Ga0307410_10884824
239 Ga0307416_101857875
240 Ga0395899_0008411
241 Ga0395899_0058024
242 Ga0395899_0202927
243 Ga0395900_0017765
244 Ga0395900_0057803
245 Ga0395900_0231241
246 Ga0395900_0559004
247 Ga0395900_0592434
248 Ga0395900_0694903
249 Ga0395900_0797841
250 Ga0395898_0013144
251 Ga0395898_0025710
252 Ga0395898_0027894
253 Ga0395905_0000065
254 Ga0395905_0000712
255 Ga0395905_0001008
256 Ga0395905_0004994
257 Ga0395905_0029328
258 Ga0395905_0060975
259 Ga0395905_0094357
260 Ga0395905_0117392
261 Ga0395905_0132594
262 Ga0395905_0152532
263 Ga0395905_0212529
264 Ga0395905_0485856
265 Ga0395905_0769646
266 Ga0395905_0917592
267 Ga0395905_1025974
268 Ga0395905_1434322
269 Ga0395901_0063856
270 Ga0395901_0066320
271 Ga0395901_0125144
272 Ga0395901_0125942
273 Ga0395901_0126887
274 Ga0395901_0163006
275 Ga0395901_0166883
276 Ga0395901_0231255
277 Ga0395901_0289456
278 Ga0395901_0317045
279 Ga0395901_0426014
280 Ga0395901_0520417
281 Ga0436365_1197994
282 Ga0439439_0007053
283 Ga0439447_106654
284 Ga0451807_0510689
285 Ga0451845_0456214
286 Ga0451843_1379923
287 Ga0439431_0073053
288 Ga0439433_0005302
289 Ga0439433_0023788
290 Ga0439449_0000980
291 Ga0439449_0007705
292 Ga0439449_0029298
293 Ga0439457_062298
294 Ga0439462_0002628
295 Ga0450912_008021
296 Ga0450914_013113
297 Ga0450905_026109
298 Ga0450916_014494
299 Ga0450893_0000252
300 Ga0450893_0002220
301 Ga0451577_1157106
302 Ga0451577_1609886
303 Ga0466969_0006408
304 Ga0466969_0013252
305 Ga0466969_0151461
306 Ga0466972_0213218
307 Ga0466966_0001562
308 Ga0466966_0204836
309 Ga0466961_0004360
310 Ga0466961_0017030
311 Ga0466961_0133847
312 Ga0466961_0289407
313 Ga0466968_0013022
314 Ga0466957_0049117
315 Ga0466957_0142068
316 Ga0466960_0053971
317 Ga0466959_0003021
318 Ga0466959_0042886
319 Ga0451576_1535581
320 Ga0495636_0379634
321 Ga0501031_0476727
322 Ga0501043_0031313
323 Ga0501046_0167471
324 Ga0501047_0128501
325 Ga0501206_048488
326 Ga0501080_0166544
327 Ga0501264_027834
328 Ga0501035_0073544
329 Ga0501044_0227238
330 nmdc:mga03n38_183114_c1
331 nmdc:mga0yw44_11725_c1
332 nmdc:mga0yw44_593751_c1
333 nmdc:mga0yw44_93655_c2
334 nmdc:mga0k408_52781_c1
335 nmdc:mga0k408_93592_c1
336 nmdc:mga06z11_534787_c1
337 nmdc:mga07m45_230285_c1
338 Ga0466962_0228668

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

7

130

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1k68-assembly1.cif.gz_B crystal structure of the phosphorylated cyanobacterial phytochrome response regulator rcpa 0.9292 5 140
3h1g-assembly1.cif.gz_A crystal structure of chey mutant t84a of helicobacter pylori 0.92 5 133
3h1e-assembly1.cif.gz_A crystal structure of mg(2+) and beh(3)(-)-bound chey of helicobacter pylori 0.9193 5 133
3h1f-assembly1.cif.gz_A crystal structure of chey mutant d53a of helicobacter pylori 0.9148 5 133
1k66-assembly1.cif.gz_B crystal structure of the cyanobacterial phytochrome response regulator, rcpb 0.8984 2 137
ID Description Score Start End Superfamily
af_O14283_368_529_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.923 6 139 3.40.50.2300
3h1eA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9193 5 133 3.40.50.2300
1jlkA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9182 5 138 3.40.50.2300
af_P69228_9_89_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9023 5 95 3.40.50.2300
af_Q5A4X5_425_557_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9019 7 139 3.40.50.2300
ID Description Score Start End GO Terms
AF-F5Y490-F1-model_v4 Candidate response regulator, CheY 0.9944 4 140 GO:0000160
AF-A0A0Q5Z6K7-F1-model_v4 Two-component system response regulator 0.9936 4 140 GO:0000160
AF-A0A4Q5W6D9-F1-model_v4 deleted 0.9894 5 139
AF-A0A7W0WN54-F1-model_v4 Response regulator 0.9731 4 140 GO:0000160
AF-A0A7W1KL48-F1-model_v4 Response regulator 0.9703 38 138 GO:0000160

Map