F254238

General Info

Members Datasets Scaffolds Average Seq Length
169 95 338 307

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10202504|Ga0070681_102025041
Length 325
Sequence MIDAVLLIAFGGPRAPAEIRPFLDIVTRGRRIPAERLEEVAHHYEQMPGGGSPLNELTEAQADGLRAALAAAGRRLPVFIGMRNWHPFLHETLAEMVARGHRRALAIILSSFRTEASWERYVADVAAARERVPGAPEIVFAPPWFEHPRFIAAAADGAGRALAEVPAAERADTPLVFTAHSVPVSMAEASPYVADFTGTARAVAERVGHARWSLAYQSRSGNPRDPWLEPDVGDIIRAVAKEGARHVVVSPVGFVCDHVEVLYDLDVEARWIAAEHGVTLHRAPAMNAHPEFVAMLADLVHDALDTAPSPVRSTYRTDESEPASA

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
12 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
13 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
59 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
61 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
62 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
63 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
64 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
65 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
66 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
67 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
68 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
69 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
70 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
71 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
72 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
73 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
77 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
78 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
79 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
80 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
81 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
82 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
83 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
84 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
85 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
86 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
87 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
88 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
89 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
90 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
91 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
92 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
93 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
94 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
95 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.59
Rhizosphere 99.41
Stem 0
Stem Tuber 0
Unclassified 3.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10202504 3300005458 Bacteria 1903
2 Ga0068869_100003667 3300005334 Bacteria 9439
3 Ga0070680_100268599 3300005336 Bacteria 1444
4 Ga0070691_10058612 3300005341 Bacteria 1849
5 Ga0070692_10004538 3300005345 Bacteria 5810
6 Ga0070692_10073213 3300005345 Bacteria 1830
7 Ga0070669_100061352 3300005353 Bacteria 2763
8 Ga0070705_100008371 3300005440 Bacteria 5121
9 Ga0070705_100062748 3300005440 Bacteria 2214
10 Ga0070694_100000216 3300005444 Bacteria 30198
11 Ga0070694_100051005 3300005444 Bacteria 2791
12 Ga0070694_100203801 3300005444 Bacteria 1476
13 Ga0070694_100322773 3300005444 Bacteria 1189
14 Ga0070708_100049581 3300005445 Bacteria 3715
15 Ga0070662_100046563 3300005457 Bacteria 3116
16 Ga0070681_10358762 3300005458 Bacteria 1368
17 Ga0070695_100235898 3300005545 Bacteria 1325
18 Ga0070696_100060082 3300005546 Bacteria 2658
19 Ga0070696_100085030 3300005546 Bacteria 2245
20 Ga0070704_100001155 3300005549 Bacteria 13789
21 Ga0070704_100009508 3300005549 Bacteria 5878
22 Ga0068857_100143901 3300005577 Bacteria 2156
23 Ga0068857_100478122 3300005577 Bacteria 1167
24 Ga0068854_100318275 3300005578 Bacteria 1264
25 Ga0068859_100576844 3300005617 Bacteria 1218
26 Ga0068861_100347574 3300005719 Bacteria 1300
27 Ga0068862_100156534 3300005844 Bacteria 2031
28 Ga0081455_10151997 3300005937 Bacteria 1784
29 Ga0081539_10000069 3300005985 Bacteria 236854
30 Ga0070712_100004036 3300006175 Bacteria 9008
31 Ga0075428_100000294 3300006844 Bacteria 48733
32 Ga0075428_100180259 3300006844 Bacteria 2287
33 Ga0075430_100000830 3300006846 Bacteria 24167
34 Ga0075430_100119371 3300006846 Bacteria 2198
35 Ga0075431_100019024 3300006847 Bacteria 6998
36 Ga0075431_100166319 3300006847 Bacteria 2267
37 Ga0075433_10000788 3300006852 Bacteria 21927
38 Ga0075433_10017454 3300006852 Bacteria 5944
39 Ga0075433_10048462 3300006852 Bacteria 3694
40 Ga0075433_10085510 3300006852 Bacteria 2784
41 Ga0075434_100023090 3300006871 Bacteria 6056
42 Ga0075434_100044553 3300006871 Bacteria 4401
43 Ga0075434_100057191 3300006871 Bacteria 3876
44 Ga0075434_100088900 3300006871 Bacteria 3091
45 Ga0075434_100099759 3300006871 Bacteria 2909
46 Ga0075434_100102796 3300006871 Bacteria 2865
47 Ga0075429_100000021 3300006880 Bacteria 69066
48 Ga0075429_100008139 3300006880 Bacteria 9115
49 Ga0075429_100044808 3300006880 Bacteria 3848
50 Ga0075429_100138026 3300006880 Bacteria 2134
51 Ga0068865_100360729 3300006881 Unclassified 1180
52 Ga0075436_100023520 3300006914 Bacteria 4232
53 Ga0097620_100576872 3300006931 Bacteria 1218
54 Ga0075435_100001691 3300007076 Bacteria 14333
55 Ga0075435_100104439 3300007076 Bacteria 2350
56 Ga0099794_10023870 3300007265 Bacteria 2801
57 Ga0111539_10007860 3300009094 Bacteria 13618
58 Ga0111539_10071908 3300009094 Bacteria 4081
59 Ga0114129_10001066 3300009147 Bacteria 36022
60 Ga0114129_10003671 3300009147 Bacteria 21597
61 Ga0114129_10014751 3300009147 Bacteria 11133
62 Ga0114129_10019241 3300009147 Bacteria 9726
63 Ga0114129_10043753 3300009147 Bacteria 6300
64 Ga0114129_10189560 3300009147 Bacteria 2793
65 Ga0114129_10215719 3300009147 Bacteria 2592
66 Ga0114129_10418287 3300009147 Bacteria 1763
67 Ga0114129_10666076 3300009147 Bacteria 1341
68 Ga0114129_10692953 3300009147 Bacteria 1310
69 Ga0105243_10117842 3300009148 Bacteria 2233
70 Ga0105241_10145694 3300009174 Bacteria 1932
71 Ga0105248_10030389 3300009177 Bacteria 6031
72 Ga0105249_10617862 3300009553 Bacteria 1139
73 Ga0163162_10016656 3300013306 Bacteria 7184
74 Ga0157375_10066268 3300013308 Bacteria 3604
75 Ga0157380_10316432 3300014326 Bacteria 1445
76 Ga0207654_10126262 3300025911 Bacteria 1613
77 Ga0207707_10153427 3300025912 Bacteria 2013
78 Ga0207693_10003550 3300025915 Bacteria 13318
79 Ga0207660_10161565 3300025917 Bacteria 1729
80 Ga0207660_10296879 3300025917 Bacteria 1286
81 Ga0207681_10044234 3300025923 Bacteria 2984
82 Ga0207659_10125138 3300025926 Bacteria 1976
83 Ga0207706_10029130 3300025933 Bacteria 4930
84 Ga0207709_10163875 3300025935 Bacteria 1553
85 Ga0207704_10326702 3300025938 Bacteria 1185
86 Ga0207665_10186644 3300025939 Bacteria 1504
87 Ga0207689_10031342 3300025942 Bacteria 4427
88 Ga0207689_10117122 3300025942 Bacteria 2190
89 Ga0207668_10152623 3300025972 Bacteria 1790
90 Ga0207658_10208942 3300025986 Bacteria 1635
91 Ga0207641_10105257 3300026088 Bacteria 2492
92 Ga0207641_10123438 3300026088 Bacteria 2315
93 Ga0207641_10629000 3300026088 Bacteria 1053
94 Ga0207648_10089645 3300026089 Bacteria 2687
95 Ga0207676_10114764 3300026095 Bacteria 2260
96 Ga0207428_10000068 3300027907 Bacteria 150215
97 Ga0268264_10046026 3300028381 Bacteria 3623
98 Ga0265330_10011552 3300031235 Bacteria 4138
99 Ga0307408_100177363 3300031548 Bacteria 1706
100 Ga0307411_10010803 3300032005 Bacteria 4889
101 Ga0373931_0004897 3300035691 Bacteria 6154
102 Ga0373931_0213202 3300035691 Bacteria 1159
103 Ga0395900_0002115 3300037418 Bacteria 22246
104 Ga0395898_0005970 3300037466 Bacteria 13078
105 Ga0395901_0000511 3300038443 Bacteria 45007
106 Ga0439455_0013314 3300042012 Bacteria 1861
107 Ga0451576_0171034 3300045051 Bacteria 2268
108 Ga0451576_0621231 3300045051 Unclassified 1135
109 Ga0495603_0072187 3300046455 Bacteria 2028
110 Ga0495580_0000018 3300046472 Bacteria 92458
111 Ga0495659_0011979 3300046664 Bacteria 2800
112 Ga0496106_0037490 3300048909 Bacteria 3627
113 Ga0501036_0251055 3300049572 Bacteria 1483
114 Ga0501039_0277160 3300049575 Bacteria 1318
115 Ga0501042_0026625 3300049578 Bacteria 4063
116 Ga0501072_0003875 3300049588 Bacteria 11313
117 Ga0501072_0340293 3300049588 Bacteria 1192
118 Ga0501075_0022910 3300049591 Bacteria 4567
119 Ga0501075_0065791 3300049591 Bacteria 2735
120 Ga0501076_0026541 3300049592 Bacteria 4488
121 Ga0501076_0045746 3300049592 Bacteria 3456
122 Ga0501077_0062520 3300049593 Bacteria 2362
123 Ga0501077_0193714 3300049593 Bacteria 1291
124 Ga0501077_0245643 3300049593 Unclassified 1138
125 Ga0501079_0000760 3300049741 Bacteria 21994
126 Ga0501080_0054057 3300049742 Bacteria 3740
127 Ga0501081_0035348 3300049743 Bacteria 3401
128 Ga0501081_0059957 3300049743 Bacteria 2635
129 Ga0501045_0200416 3300049824 Bacteria 1487
130 nmdc:mga05p37_1707_c1 3300050507 Bacteria 25583
131 nmdc:mga05p37_195371_c1 3300050507 Bacteria 2454
132 nmdc:mga05p37_3218_c1 3300050507 Bacteria 19019
133 nmdc:mga05p37_39484_c1 3300050507 Bacteria 5795
134 nmdc:mga05p37_50218_c1 3300050507 Bacteria 5130
135 nmdc:mga05p37_55698_c1 3300050507 Bacteria 4314
136 nmdc:mga09592_51356_c1 3300050508 Bacteria 3478
137 nmdc:mga09592_52663_c1 3300050508 Bacteria 3435
138 nmdc:mga09592_5731_c1 3300050508 Bacteria 10127
139 nmdc:mga09592_651_c1 3300050508 Bacteria 26444
140 nmdc:mga0qj67_20208_c1 3300050509 Bacteria 5097
141 nmdc:mga0qj67_2928_c1 3300050509 Bacteria 12248
142 nmdc:mga06r32_120_c1 3300050510 Bacteria 56649
143 nmdc:mga06r32_129831_c1 3300050510 Bacteria 2491
144 nmdc:mga06r32_13516_c1 3300050510 Bacteria 7399
145 nmdc:mga06r32_322901_c1 3300050510 Unclassified 1529
146 nmdc:mga08y16_1150_c1 3300050511 Bacteria 26070
147 nmdc:mga0n895_18084_c1 3300050512 Bacteria 6516
148 nmdc:mga0n895_280158_c1 3300050512 Bacteria 1691
149 nmdc:mga0n895_3061_c1 3300050512 Bacteria 13291
150 nmdc:mga0n895_35524_c1 3300050512 Bacteria 4806
151 nmdc:mga0rr50_148212_c1 3300050513 Bacteria 1894
152 nmdc:mga0rr50_22937_c1 3300050513 Bacteria 4294
153 nmdc:mga08x19_6743_c1 3300050514 Bacteria 6818
154 nmdc:mga08x19_95755_c1 3300050514 Unclassified 1964
155 nmdc:mga0a205_161105_c1 3300050515 Bacteria 2140
156 nmdc:mga0a205_174870_c1 3300050515 Bacteria 2043
157 nmdc:mga0a205_23280_c1 3300050515 Bacteria 5874
158 nmdc:mga0a205_3020_c1 3300050515 Bacteria 14913
159 nmdc:mga0a205_306627_c1 3300050515 Bacteria 1460
160 nmdc:mga0a205_79424_c1 3300050515 Bacteria 3170
161 Ga0501084_0029233 3300054114 Bacteria 4610
162 Ga0501084_0096886 3300054114 Bacteria 2477
163 Ga0501084_0165676 3300054114 Bacteria 1865
164 Ga0501084_0299410 3300054114 Unclassified 1358
165 Ga0501082_0148410 3300060353 Bacteria 2036
166 Ga0501082_0345970 3300060353 Bacteria 1296
167 Ga0530510_0101542 3300061734 Bacteria 2103
168 Ga0530510_0151032 3300061734 Bacteria 1715
169 Ga0530510_0182182 3300061734 Bacteria 1558
170 Ga0070681_10202504
171 Ga0068869_100003667
172 Ga0070680_100268599
173 Ga0070691_10058612
174 Ga0070692_10004538
175 Ga0070692_10073213
176 Ga0070669_100061352
177 Ga0070705_100008371
178 Ga0070705_100062748
179 Ga0070694_100000216
180 Ga0070694_100051005
181 Ga0070694_100203801
182 Ga0070694_100322773
183 Ga0070708_100049581
184 Ga0070662_100046563
185 Ga0070681_10358762
186 Ga0070695_100235898
187 Ga0070696_100060082
188 Ga0070696_100085030
189 Ga0070704_100001155
190 Ga0070704_100009508
191 Ga0068857_100143901
192 Ga0068857_100478122
193 Ga0068854_100318275
194 Ga0068859_100576844
195 Ga0068861_100347574
196 Ga0068862_100156534
197 Ga0081455_10151997
198 Ga0081539_10000069
199 Ga0070712_100004036
200 Ga0075428_100000294
201 Ga0075428_100180259
202 Ga0075430_100000830
203 Ga0075430_100119371
204 Ga0075431_100019024
205 Ga0075431_100166319
206 Ga0075433_10000788
207 Ga0075433_10017454
208 Ga0075433_10048462
209 Ga0075433_10085510
210 Ga0075434_100023090
211 Ga0075434_100044553
212 Ga0075434_100057191
213 Ga0075434_100088900
214 Ga0075434_100099759
215 Ga0075434_100102796
216 Ga0075429_100000021
217 Ga0075429_100008139
218 Ga0075429_100044808
219 Ga0075429_100138026
220 Ga0068865_100360729
221 Ga0075436_100023520
222 Ga0097620_100576872
223 Ga0075435_100001691
224 Ga0075435_100104439
225 Ga0099794_10023870
226 Ga0111539_10007860
227 Ga0111539_10071908
228 Ga0114129_10001066
229 Ga0114129_10003671
230 Ga0114129_10014751
231 Ga0114129_10019241
232 Ga0114129_10043753
233 Ga0114129_10189560
234 Ga0114129_10215719
235 Ga0114129_10418287
236 Ga0114129_10666076
237 Ga0114129_10692953
238 Ga0105243_10117842
239 Ga0105241_10145694
240 Ga0105248_10030389
241 Ga0105249_10617862
242 Ga0163162_10016656
243 Ga0157375_10066268
244 Ga0157380_10316432
245 Ga0207654_10126262
246 Ga0207707_10153427
247 Ga0207693_10003550
248 Ga0207660_10161565
249 Ga0207660_10296879
250 Ga0207681_10044234
251 Ga0207659_10125138
252 Ga0207706_10029130
253 Ga0207709_10163875
254 Ga0207704_10326702
255 Ga0207665_10186644
256 Ga0207689_10031342
257 Ga0207689_10117122
258 Ga0207668_10152623
259 Ga0207658_10208942
260 Ga0207641_10105257
261 Ga0207641_10123438
262 Ga0207641_10629000
263 Ga0207648_10089645
264 Ga0207676_10114764
265 Ga0207428_10000068
266 Ga0268264_10046026
267 Ga0265330_10011552
268 Ga0307408_100177363
269 Ga0307411_10010803
270 Ga0373931_0004897
271 Ga0373931_0213202
272 Ga0395900_0002115
273 Ga0395898_0005970
274 Ga0395901_0000511
275 Ga0439455_0013314
276 Ga0451576_0171034
277 Ga0451576_0621231
278 Ga0495603_0072187
279 Ga0495580_0000018
280 Ga0495659_0011979
281 Ga0496106_0037490
282 Ga0501036_0251055
283 Ga0501039_0277160
284 Ga0501042_0026625
285 Ga0501072_0003875
286 Ga0501072_0340293
287 Ga0501075_0022910
288 Ga0501075_0065791
289 Ga0501076_0026541
290 Ga0501076_0045746
291 Ga0501077_0062520
292 Ga0501077_0193714
293 Ga0501077_0245643
294 Ga0501079_0000760
295 Ga0501080_0054057
296 Ga0501081_0035348
297 Ga0501081_0059957
298 Ga0501045_0200416
299 nmdc:mga05p37_1707_c1
300 nmdc:mga05p37_195371_c1
301 nmdc:mga05p37_3218_c1
302 nmdc:mga05p37_39484_c1
303 nmdc:mga05p37_50218_c1
304 nmdc:mga05p37_55698_c1
305 nmdc:mga09592_51356_c1
306 nmdc:mga09592_52663_c1
307 nmdc:mga09592_5731_c1
308 nmdc:mga09592_651_c1
309 nmdc:mga0qj67_20208_c1
310 nmdc:mga0qj67_2928_c1
311 nmdc:mga06r32_120_c1
312 nmdc:mga06r32_129831_c1
313 nmdc:mga06r32_13516_c1
314 nmdc:mga06r32_322901_c1
315 nmdc:mga08y16_1150_c1
316 nmdc:mga0n895_18084_c1
317 nmdc:mga0n895_280158_c1
318 nmdc:mga0n895_3061_c1
319 nmdc:mga0n895_35524_c1
320 nmdc:mga0rr50_148212_c1
321 nmdc:mga0rr50_22937_c1
322 nmdc:mga08x19_6743_c1
323 nmdc:mga08x19_95755_c1
324 nmdc:mga0a205_161105_c1
325 nmdc:mga0a205_174870_c1
326 nmdc:mga0a205_23280_c1
327 nmdc:mga0a205_3020_c1
328 nmdc:mga0a205_306627_c1
329 nmdc:mga0a205_79424_c1
330 Ga0501084_0029233
331 Ga0501084_0096886
332 Ga0501084_0165676
333 Ga0501084_0299410
334 Ga0501082_0148410
335 Ga0501082_0345970
336 Ga0530510_0101542
337 Ga0530510_0151032
338 Ga0530510_0182182

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00762

Ferrochelatase

Ferrochelatase

2

304

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2po5-assembly1.cif.gz_B crystal structure of human ferrochelatase mutant with his 263 replaced by cys 0.8221 2 263
2q3j-assembly1.cif.gz_A crystal structure of the his183ala variant of bacillus subtilis ferrochelatase in complex with n-methyl mesoporphyrin 0.8166 4 263
8aw7-assembly1.cif.gz_A structure of coproporphyrin iii-lmcpfc r45l 0.8105 1 263
8ofl-assembly1.cif.gz_A coproporphyrin iii - lmcpfc complex soaked 4min with fe2+ 0.8103 1 263
2po5-assembly1.cif.gz_B crystal structure of human ferrochelatase mutant with his 263 replaced by cys 0.8049 2 263
ID Description Score Start End Superfamily
af_P9WNE3_5_124_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9231 4 128 3.40.50.1400
af_P9WNE3_5_124_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9158 4 128 3.40.50.1400
af_I1K8C0_106_244_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8925 4 108 3.40.50.1400
af_Q2FXA4_2_144_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8236 4 140 3.40.50.1400
af_Q9V9S8_29_187_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7928 4 140 3.40.50.1400
ID Description Score Start End GO Terms
AF-A0A355DFX8-F1-model_v4 Ferrochelatase 0.9803 2 105 GO:0004325
GO:0006783
AF-A0A534RY03-F1-model_v4 Ferrochelatase 0.9779 65 151 GO:0004325
GO:0006783
AF-A0A382CW72-F1-model_v4 Ferrochelatase 0.9744 4 152 GO:0004325
GO:0006783
AF-T0Y6Q1-F1-model_v4 Ferrochelatase 0.972 2 103 GO:0004325
GO:0006783
AF-A0A2V9XY23-F1-model_v4 Ferrochelatase 0.9685 1 96 GO:0004325
GO:0006783

Map