F253704

General Info

Members Datasets Scaffolds Average Seq Length
168 117 336 227

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2889295896|2889296335
Length 214
Sequence APSILSADFSMLAQEIADVERGGADWIHVDVMDGHFVPNITIGPLVVEAIRPKTKLPLDVHLMIEQPDRYVPAFAKAGADLISVHTEACVHLHRTLHLIKEQGVKAGVVLNPATPLSVLEHVMDDALDLVLLMTVNPGFGGQNFITGMLPKIAKLREMLNARGLQAVDIEVDGGINEETAKLAVEAGANVLVAGSAVFNRPNRADAIRAIRGLL

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
7 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
8 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
9 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
52 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
53 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
54 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
55 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
56 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
57 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
58 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
59 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
60 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
61 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
62 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
63 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
64 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
65 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
66 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
67 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
68 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
69 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
70 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
71 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
72 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
73 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
74 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
75 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
76 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
77 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
78 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
79 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
80 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
81 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
82 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
83 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
84 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
85 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
86 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
87 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
88 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
93 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
94 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
95 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
96 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
97 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
98 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
99 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
100 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
101 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
102 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
103 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
104 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
105 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
106 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
107 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
108 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
109 2842682962 Bacillus sp. R-72492 Isolate Unclassified
110 2849139964 Bacillus sp. R-71875 Isolate Unclassified
111 2857581216 Bacillus sp. R-71922 Isolate Unclassified
112 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
113 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
114 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
115 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
116 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
117 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.45
Metatranscriptomes 0
Isolates 6.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.6
Nodule 0.6
Rhizoplane 0
Rhizosphere 93.45
Stem 0
Stem Tuber 0
Unclassified 1.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10202652 3300005290 Bacteria 1102
2 Ga0070676_10017401 3300005328 Bacteria 3979
3 Ga0070670_100010791 3300005331 Bacteria 7803
4 Ga0070692_10000326 3300005345 Bacteria 13721
5 Ga0070668_100218096 3300005347 Bacteria 1572
6 Ga0070705_100094454 3300005440 Bacteria 1872
7 Ga0070694_100000319 3300005444 Bacteria 25918
8 Ga0070694_100000474 3300005444 Bacteria 22024
9 Ga0070694_100042065 3300005444 Bacteria 3050
10 Ga0070694_100061996 3300005444 Bacteria 2554
11 Ga0070694_100592127 3300005444 Bacteria 892
12 Ga0070662_100542411 3300005457 Bacteria 974
13 Ga0068867_100027261 3300005459 Bacteria 4104
14 Ga0070706_100772429 3300005467 Bacteria 890
15 Ga0070698_100011468 3300005471 Bacteria 9405
16 Ga0070698_100363587 3300005471 Bacteria 1379
17 Ga0070699_100000001 3300005518 Bacteria 910751
18 Ga0070699_100000988 3300005518 Bacteria 26474
19 Ga0070699_100309287 3300005518 Bacteria 1418
20 Ga0070697_100000096 3300005536 Bacteria 73635
21 Ga0070697_100010520 3300005536 Bacteria 7222
22 Ga0070697_100081293 3300005536 Bacteria 2670
23 Ga0070697_100593033 3300005536 Bacteria 973
24 Ga0070686_100397071 3300005544 Bacteria 1048
25 Ga0070695_100024391 3300005545 Bacteria 3725
26 Ga0070696_100000961 3300005546 Bacteria 18664
27 Ga0070696_100004021 3300005546 Bacteria 9804
28 Ga0070696_100294621 3300005546 Bacteria 1241
29 Ga0070696_100675704 3300005546 Bacteria 840
30 Ga0070696_100759928 3300005546 Bacteria 795
31 Ga0070665_100002789 3300005548 Bacteria 18949
32 Ga0070704_100004460 3300005549 Bacteria 8083
33 Ga0070704_100127305 3300005549 Bacteria 1967
34 Ga0070704_100271521 3300005549 Bacteria 1401
35 Ga0068861_100237560 3300005719 Bacteria 1548
36 Ga0068863_100632026 3300005841 Bacteria 1061
37 Ga0081539_10005248 3300005985 Bacteria 13372
38 Ga0075432_10070409 3300006058 Bacteria 1256
39 Ga0075428_100019841 3300006844 Bacteria 7440
40 Ga0075430_100012703 3300006846 Bacteria 7176
41 Ga0075430_100050318 3300006846 Bacteria 3514
42 Ga0075430_100095699 3300006846 Bacteria 2482
43 Ga0075431_100005490 3300006847 Bacteria 12520
44 Ga0075431_100020423 3300006847 Bacteria 6768
45 Ga0075431_100020814 3300006847 Bacteria 6703
46 Ga0075431_100056662 3300006847 Unclassified 4041
47 Ga0075431_100118156 3300006847 Bacteria 2736
48 Ga0075433_10030620 3300006852 Bacteria 4592
49 Ga0075433_10259695 3300006852 Bacteria 1540
50 Ga0075434_100027701 3300006871 Bacteria 5564
51 Ga0075429_100080890 3300006880 Bacteria 2833
52 Ga0075429_100221718 3300006880 Unclassified 1656
53 Ga0075429_100419426 3300006880 Bacteria 1172
54 Ga0068865_100001072 3300006881 Bacteria 15770
55 Ga0068865_100402303 3300006881 Bacteria 1122
56 Ga0075435_100140735 3300007076 Bacteria 2024
57 Ga0111539_10010538 3300009094 Bacteria 11638
58 Ga0111539_10022371 3300009094 Bacteria 7770
59 Ga0114129_10010491 3300009147 Bacteria 13216
60 Ga0114129_10012275 3300009147 Bacteria 12189
61 Ga0114129_10028858 3300009147 Bacteria 7861
62 Ga0114129_10152145 3300009147 Bacteria 3166
63 Ga0114129_10560892 3300009147 Bacteria 1484
64 Ga0105243_10025372 3300009148 Bacteria 4529
65 Ga0105242_10015416 3300009176 Bacteria 5936
66 Ga0105248_10723642 3300009177 Bacteria 1123
67 Ga0105249_10134315 3300009553 Bacteria 2366
68 Ga0105249_10531086 3300009553 Unclassified 1225
69 Ga0105239_11394659 3300010375 Bacteria 809
70 Ga0207645_10023984 3300025907 Bacteria 3959
71 Ga0207645_10521826 3300025907 Bacteria 805
72 Ga0207684_10371781 3300025910 Bacteria 1230
73 Ga0207660_10332586 3300025917 Bacteria 1215
74 Ga0207681_10526215 3300025923 Bacteria 971
75 Ga0207650_10005546 3300025925 Bacteria 8611
76 Ga0207706_10375515 3300025933 Bacteria 1234
77 Ga0207712_10242762 3300025961 Bacteria 1452
78 Ga0207703_10565846 3300026035 Bacteria 1073
79 Ga0207708_10245795 3300026075 Bacteria 1440
80 Ga0207641_10493985 3300026088 Bacteria 1188
81 Ga0207648_10008617 3300026089 Bacteria 9859
82 Ga0207675_100002329 3300026118 Bacteria 18829
83 Ga0268266_10060837 3300028379 Bacteria 3256
84 Ga0307408_100154079 3300031548 Bacteria 1817
85 Ga0316576_10014017 3300031727 Bacteria 5345
86 Ga0316576_10144924 3300031727 Bacteria 1789
87 Ga0307413_10224919 3300031824 Bacteria 1373
88 Ga0307410_10098175 3300031852 Bacteria 2094
89 Ga0307409_100008970 3300031995 Bacteria 6111
90 Ga0307409_100288533 3300031995 Bacteria 1520
91 Ga0307409_100861481 3300031995 Bacteria 917
92 Ga0307416_100554369 3300032002 Bacteria 1223
93 Ga0307411_10093637 3300032005 Bacteria 2104
94 Ga0307415_100006717 3300032126 Bacteria 6231
95 Ga0373945_0030161 3300035116 Bacteria 1910
96 Ga0373943_0019644 3300035170 Bacteria 3108
97 Ga0373937_0249827 3300036401 Bacteria 1672
98 Ga0373925_0000505 3300037068 Bacteria 39364
99 Ga0373925_0618470 3300037068 Bacteria 892
100 Ga0400484_17456 3300038725 Bacteria 5053
101 Ga0400490_13806 3300038726 Bacteria 2085
102 Ga0400488_18008 3300038741 Bacteria 1065
103 Ga0400488_25206 3300038741 Bacteria 1133
104 Ga0400483_223475 3300039062 Bacteria 8753
105 Ga0439453_0031477 3300041408 Bacteria 1007
106 Ga0439433_0006031 3300041999 Bacteria 2605
107 Ga0439462_0017705 3300042015 Bacteria 1846
108 Ga0495629_0000010 3300046459 Bacteria 340114
109 Ga0495580_0138756 3300046472 Bacteria 1686
110 Ga0495639_0000838 3300046475 Bacteria 14013
111 Ga0495594_0101077 3300046499 Bacteria 1622
112 Ga0495666_0000171 3300046526 Bacteria 27416
113 Ga0495586_0004999 3300046535 Bacteria 7096
114 Ga0495622_0006771 3300046557 Bacteria 5317
115 Ga0495634_0325751 3300046642 Bacteria 924
116 Ga0495635_0000403 3300046663 Bacteria 27473
117 Ga0495659_0012611 3300046664 Bacteria 2742
118 Ga0495658_0007368 3300046683 Bacteria 5441
119 Ga0495613_0283132 3300046689 Bacteria 1151
120 Ga0495600_0024680 3300046809 Bacteria 3871
121 Ga0495581_0002474 3300047315 Bacteria 10455
122 Ga0495636_0028570 3300047318 Bacteria 2276
123 Ga0495676_0014882 3300047321 Bacteria 6946
124 Ga0495680_0000604 3300047322 Bacteria 40524
125 Ga0495684_0044551 3300047471 Bacteria 3397
126 Ga0501039_0156308 3300049575 Bacteria 1791
127 Ga0501041_0142241 3300049577 Bacteria 1496
128 Ga0501042_0024850 3300049578 Bacteria 4205
129 Ga0501048_0016990 3300049582 Bacteria 5363
130 Ga0501076_0074329 3300049592 Bacteria 2722
131 Ga0501079_0107709 3300049741 Bacteria 2163
132 Ga0501079_0165460 3300049741 Bacteria 1725
133 Ga0501081_0037563 3300049743 Bacteria 3305
134 Ga0501035_0129051 3300049822 Bacteria 2205
135 nmdc:mga05p37_16602_c1 3300050507 Bacteria 8868
136 nmdc:mga05p37_4994_c1 3300050507 Bacteria 15546
137 nmdc:mga05p37_71601_c1 3300050507 Bacteria 4265
138 nmdc:mga05p37_75213_c1 3300050507 Bacteria 4157
139 nmdc:mga09592_149989_c1 3300050508 Bacteria 2011
140 nmdc:mga0qj67_145720_c1 3300050509 Bacteria 1920
141 nmdc:mga0qj67_80714_c1 3300050509 Bacteria 2607
142 nmdc:mga06r32_161996_c1 3300050510 Bacteria 2219
143 nmdc:mga06r32_216035_c1 3300050510 Bacteria 1905
144 nmdc:mga06r32_244839_c1 3300050510 Bacteria 1780
145 nmdc:mga06r32_278359_c1 3300050510 Bacteria 1660
146 nmdc:mga06r32_63876_c1 3300050510 Bacteria 3550
147 nmdc:mga06r32_663130_c1 3300050510 Bacteria 1011
148 nmdc:mga08y16_12936_c1 3300050511 Bacteria 8778
149 nmdc:mga08y16_55214_c1 3300050511 Bacteria 4151
150 nmdc:mga0rr50_245350_c1 3300050513 Bacteria 1486
151 nmdc:mga0rr50_356656_c1 3300050513 Bacteria 1230
152 nmdc:mga0a205_221568_c1 3300050515 Bacteria 1777
153 nmdc:mga0a205_87078_c1 3300050515 Bacteria 3018
154 Ga0500566_0003958 3300053094 Bacteria 8837
155 Ga0501084_0021135 3300054114 Bacteria 5428
156 Ga0501082_0801723 3300060353 Bacteria 824
157 Ga0530510_0228956 3300061734 Bacteria 1382
158 2889296335 2889295896 Bacteria 4704906
159 2816863936 2816332186 Bacteria 5331395
160 2842685168 2842682962 Bacteria 5589973
161 2849140850 2849139964 Bacteria 5613304
162 2857584307 2857581216 Bacteria 5522813
163 2898907470 2898907183 Bacteria 4067722
164 2915602319 2915597211 Bacteria 6475886
165 2981288078 2981284811 Bacteria 4641497
166 2981292207 2981289755 Bacteria 4641509
167 2981983697 2981980479 Bacteria 4641628
168 2981988264 2981985349 Bacteria 4641497
169 Ga0065712_10202652
170 Ga0070676_10017401
171 Ga0070670_100010791
172 Ga0070692_10000326
173 Ga0070668_100218096
174 Ga0070705_100094454
175 Ga0070694_100000319
176 Ga0070694_100000474
177 Ga0070694_100042065
178 Ga0070694_100061996
179 Ga0070694_100592127
180 Ga0070662_100542411
181 Ga0068867_100027261
182 Ga0070706_100772429
183 Ga0070698_100011468
184 Ga0070698_100363587
185 Ga0070699_100000001
186 Ga0070699_100000988
187 Ga0070699_100309287
188 Ga0070697_100000096
189 Ga0070697_100010520
190 Ga0070697_100081293
191 Ga0070697_100593033
192 Ga0070686_100397071
193 Ga0070695_100024391
194 Ga0070696_100000961
195 Ga0070696_100004021
196 Ga0070696_100294621
197 Ga0070696_100675704
198 Ga0070696_100759928
199 Ga0070665_100002789
200 Ga0070704_100004460
201 Ga0070704_100127305
202 Ga0070704_100271521
203 Ga0068861_100237560
204 Ga0068863_100632026
205 Ga0081539_10005248
206 Ga0075432_10070409
207 Ga0075428_100019841
208 Ga0075430_100012703
209 Ga0075430_100050318
210 Ga0075430_100095699
211 Ga0075431_100005490
212 Ga0075431_100020423
213 Ga0075431_100020814
214 Ga0075431_100056662
215 Ga0075431_100118156
216 Ga0075433_10030620
217 Ga0075433_10259695
218 Ga0075434_100027701
219 Ga0075429_100080890
220 Ga0075429_100221718
221 Ga0075429_100419426
222 Ga0068865_100001072
223 Ga0068865_100402303
224 Ga0075435_100140735
225 Ga0111539_10010538
226 Ga0111539_10022371
227 Ga0114129_10010491
228 Ga0114129_10012275
229 Ga0114129_10028858
230 Ga0114129_10152145
231 Ga0114129_10560892
232 Ga0105243_10025372
233 Ga0105242_10015416
234 Ga0105248_10723642
235 Ga0105249_10134315
236 Ga0105249_10531086
237 Ga0105239_11394659
238 Ga0207645_10023984
239 Ga0207645_10521826
240 Ga0207684_10371781
241 Ga0207660_10332586
242 Ga0207681_10526215
243 Ga0207650_10005546
244 Ga0207706_10375515
245 Ga0207712_10242762
246 Ga0207703_10565846
247 Ga0207708_10245795
248 Ga0207641_10493985
249 Ga0207648_10008617
250 Ga0207675_100002329
251 Ga0268266_10060837
252 Ga0307408_100154079
253 Ga0316576_10014017
254 Ga0316576_10144924
255 Ga0307413_10224919
256 Ga0307410_10098175
257 Ga0307409_100008970
258 Ga0307409_100288533
259 Ga0307409_100861481
260 Ga0307416_100554369
261 Ga0307411_10093637
262 Ga0307415_100006717
263 Ga0373945_0030161
264 Ga0373943_0019644
265 Ga0373937_0249827
266 Ga0373925_0000505
267 Ga0373925_0618470
268 Ga0400484_17456
269 Ga0400490_13806
270 Ga0400488_18008
271 Ga0400488_25206
272 Ga0400483_223475
273 Ga0439453_0031477
274 Ga0439433_0006031
275 Ga0439462_0017705
276 Ga0495629_0000010
277 Ga0495580_0138756
278 Ga0495639_0000838
279 Ga0495594_0101077
280 Ga0495666_0000171
281 Ga0495586_0004999
282 Ga0495622_0006771
283 Ga0495634_0325751
284 Ga0495635_0000403
285 Ga0495659_0012611
286 Ga0495658_0007368
287 Ga0495613_0283132
288 Ga0495600_0024680
289 Ga0495581_0002474
290 Ga0495636_0028570
291 Ga0495676_0014882
292 Ga0495680_0000604
293 Ga0495684_0044551
294 Ga0501039_0156308
295 Ga0501041_0142241
296 Ga0501042_0024850
297 Ga0501048_0016990
298 Ga0501076_0074329
299 Ga0501079_0107709
300 Ga0501079_0165460
301 Ga0501081_0037563
302 Ga0501035_0129051
303 nmdc:mga05p37_16602_c1
304 nmdc:mga05p37_4994_c1
305 nmdc:mga05p37_71601_c1
306 nmdc:mga05p37_75213_c1
307 nmdc:mga09592_149989_c1
308 nmdc:mga0qj67_145720_c1
309 nmdc:mga0qj67_80714_c1
310 nmdc:mga06r32_161996_c1
311 nmdc:mga06r32_216035_c1
312 nmdc:mga06r32_244839_c1
313 nmdc:mga06r32_278359_c1
314 nmdc:mga06r32_63876_c1
315 nmdc:mga06r32_663130_c1
316 nmdc:mga08y16_12936_c1
317 nmdc:mga08y16_55214_c1
318 nmdc:mga0rr50_245350_c1
319 nmdc:mga0rr50_356656_c1
320 nmdc:mga0a205_221568_c1
321 nmdc:mga0a205_87078_c1
322 Ga0500566_0003958
323 Ga0501084_0021135
324 Ga0501082_0801723
325 Ga0530510_0228956
326 2889296335
327 2816863936
328 2842685168
329 2849140850
330 2857584307
331 2898907470
332 2915602319
333 2981288078
334 2981292207
335 2981983697
336 2981988264

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00834

Ribul_P_3_epim

Ribulose-phosphate 3 epimerase family

1

198

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fli-assembly1.cif.gz_E the crystal structure of d-ribulose 5-phosphate 3-epimerase from streptococus pyogenes complexed with d-xylitol 5-phosphate 0.9593 5 219
7sbj-assembly1.cif.gz_C crystal structure of ribulose-phosphate 3-epimerase from stenotrophomonas maltophilia k279a 0.9562 6 221
5umf-assembly1.cif.gz_C crystal structure of a ribulose-phosphate 3-epimerase from neisseria gonorrhoeae with bound phosphate 0.9525 5 221
2fli-assembly1.cif.gz_E the crystal structure of d-ribulose 5-phosphate 3-epimerase from streptococus pyogenes complexed with d-xylitol 5-phosphate 0.9506 5 219
7u5y-assembly1.cif.gz_E crystal structure of ribulose-phosphate 3-epimerase from pseudomonas aeruginosa 0.9497 5 221
ID Description Score Start End Superfamily
af_P0AG07_1_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9614 4 221 3.20.20.70
2fliC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9578 5 220 3.20.20.70
af_Q58093_1_217_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9575 5 221 3.20.20.70
1tqjD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9481 4 217 3.20.20.70
af_P9WI51_4_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9453 4 219 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A3B8RQ74-F1-model_v4 Ribulose-phosphate 3-epimerase 0.9934 53 222 GO:0005975
GO:0016857
AF-A0A7Y5GJA3-F1-model_v4 Ribulose-phosphate 3-epimerase 0.9914 68 224 GO:0005975
GO:0016857
AF-A0A661INI8-F1-model_v4 Ribulose-phosphate 3-epimerase 0.9903 57 219 GO:0005975
GO:0016857
AF-A0A497BP16-F1-model_v4 Ribulose-phosphate 3-epimerase 0.9861 61 220 GO:0005975
GO:0016857
AF-A0A849FQY7-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9842 50 219 GO:0004750
GO:0005975
GO:0006098

Map