F253325

General Info

Members Datasets Scaffolds Average Seq Length
168 109 336 235

Family's Representative Sequence

Representative Sequence 3300046559|Ga0495667_0345569|Ga0495667_0345569_62_898
Length 278
Sequence MPALQRADPPPRPRRRQPQYVLVSAVPALSYRRVGHKGADHLAPGNTFASFDAALAAGVDMIEFDVLPERPDGSGELLLAHDYEVLGRRAAPRLAEGLAHLASSAFAEISFDVDMKLPGYELRVVDALREHGFGGRTLVTTMETDSLPIVRTAAPEIRLGWSVPKVRRNYLANPFTRPGALALATVARHFAPARLARAIRERRVEAIMCHHQLVTARMVDAVLGAGGELYVWTVDDRPTIDRLARLGVTGIISNDPRLFWDDSECARRGAEVGGVRSR

Samples

Sample ID Description Type Environment
1 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
34 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
35 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
36 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
37 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
53 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
54 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
55 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
56 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
57 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
58 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
59 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
60 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
61 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
62 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
63 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
64 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
65 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
66 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
67 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
68 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
69 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
70 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
71 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
72 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
73 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
74 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
75 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
76 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
77 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
78 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
79 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
80 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
81 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
82 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
83 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
84 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
85 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
86 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
87 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
88 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
89 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
90 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
91 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
92 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
93 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
100 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
101 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
102 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
103 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
104 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
105 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
106 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
107 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
108 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
109 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.79
Nodule 0
Rhizoplane 0
Rhizosphere 93.45
Stem 0
Stem Tuber 0
Unclassified 2.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495667_0345569 3300046559 Bacteria 940
2 JGI25407J50210_10006874 3300003373 Bacteria 2842
3 Ga0070683_100139160 3300005329 Bacteria 2299
4 Ga0070683_100392325 3300005329 Bacteria 1323
5 Ga0070682_100305636 3300005337 Bacteria 1169
6 Ga0070660_100074057 3300005339 Bacteria 2663
7 Ga0070660_100268665 3300005339 Bacteria 1394
8 Ga0070689_100328068 3300005340 Bacteria 1280
9 Ga0070671_100707663 3300005355 Bacteria 874
10 Ga0070674_100198500 3300005356 Bacteria 1548
11 Ga0070674_100569271 3300005356 Bacteria 953
12 Ga0070673_100355645 3300005364 Bacteria 1301
13 Ga0070713_100070615 3300005436 Bacteria 2949
14 Ga0070713_100514940 3300005436 Bacteria 1130
15 Ga0070700_100238967 3300005441 Bacteria 1297
16 Ga0070662_100094714 3300005457 Bacteria 2249
17 Ga0070662_100631032 3300005457 Bacteria 903
18 Ga0070684_100128494 3300005535 Bacteria 2285
19 Ga0070684_100136155 3300005535 Bacteria 2219
20 Ga0070672_100250641 3300005543 Bacteria 1491
21 Ga0070693_100202174 3300005547 Bacteria 1291
22 Ga0070664_100035466 3300005564 Bacteria 4188
23 Ga0070664_100111593 3300005564 Bacteria 2387
24 Ga0070664_100306991 3300005564 Bacteria 1435
25 Ga0068856_100015972 3300005614 Bacteria 7259
26 Ga0068862_100145671 3300005844 Bacteria 2105
27 Ga0081455_10015378 3300005937 Bacteria 7438
28 Ga0081455_10188608 3300005937 Bacteria 1555
29 Ga0081538_10000070 3300005981 Bacteria 96971
30 Ga0081538_10000309 3300005981 Bacteria 56250
31 Ga0081538_10001142 3300005981 Bacteria 28050
32 Ga0081538_10006733 3300005981 Bacteria 10052
33 Ga0081538_10009578 3300005981 Bacteria 8063
34 Ga0081538_10011562 3300005981 Bacteria 7142
35 Ga0081538_10012809 3300005981 Bacteria 6695
36 Ga0081538_10033405 3300005981 Bacteria 3425
37 Ga0081539_10009796 3300005985 Bacteria 7922
38 Ga0070717_10031153 3300006028 Bacteria 4288
39 Ga0075365_10043193 3300006038 Bacteria 2951
40 Ga0075365_10390405 3300006038 Bacteria 982
41 Ga0075363_100038102 3300006048 Bacteria 2527
42 Ga0075430_100027715 3300006846 Bacteria 4812
43 Ga0075431_100021435 3300006847 Bacteria 6608
44 Ga0105240_10029641 3300009093 Bacteria 7124
45 Ga0111539_10615876 3300009094 Bacteria 1264
46 Ga0114129_10463251 3300009147 Unclassified 1661
47 Ga0105237_10000540 3300009545 Bacteria 53364
48 Ga0105238_11058532 3300009551 Bacteria 833
49 Ga0105239_11456986 3300010375 Bacteria 791
50 Ga0157380_10225746 3300014326 Bacteria 1678
51 Ga0157379_10010795 3300014968 Bacteria 7962
52 Ga0213876_10013614 3300021384 Bacteria 4316
53 Ga0213875_10236738 3300021388 Bacteria 860
54 Ga0207647_10084414 3300025904 Bacteria 1901
55 Ga0207695_10039644 3300025913 Bacteria 5060
56 Ga0207671_10002417 3300025914 Bacteria 20009
57 Ga0207657_10368822 3300025919 Bacteria 1131
58 Ga0207700_10042651 3300025928 Bacteria 3328
59 Ga0207700_10677093 3300025928 Bacteria 920
60 Ga0207664_10403090 3300025929 Bacteria 1217
61 Ga0207690_10284131 3300025932 Bacteria 1289
62 Ga0207706_10215687 3300025933 Bacteria 1681
63 Ga0207669_10203633 3300025937 Bacteria 1439
64 Ga0207669_10341944 3300025937 Bacteria 1153
65 Ga0207691_10069524 3300025940 Bacteria 3180
66 Ga0207661_10044252 3300025944 Bacteria 3518
67 Ga0207661_10194026 3300025944 Bacteria 1782
68 Ga0207679_10105645 3300025945 Bacteria 2212
69 Ga0207679_10217933 3300025945 Bacteria 1604
70 Ga0207679_10276593 3300025945 Bacteria 1438
71 Ga0207702_10011614 3300026078 Bacteria 7339
72 Ga0207676_10184306 3300026095 Bacteria 1831
73 Ga0207698_10690168 3300026142 Bacteria 1015
74 Ga0265338_10007092 3300028800 Bacteria 14041
75 Ga0265327_10015719 3300031251 Bacteria 4862
76 Ga0265327_10030382 3300031251 Unclassified 3056
77 Ga0307413_10026358 3300031824 Bacteria 3201
78 Ga0307410_10184441 3300031852 Bacteria 1582
79 Ga0307406_10008461 3300031901 Bacteria 5742
80 Ga0307406_10018392 3300031901 Bacteria 4083
81 Ga0307406_10054562 3300031901 Bacteria 2551
82 Ga0307407_10033963 3300031903 Bacteria 2788
83 Ga0307407_10141444 3300031903 Bacteria 1553
84 Ga0307407_10196701 3300031903 Bacteria 1348
85 Ga0307407_10505564 3300031903 Bacteria 886
86 Ga0307412_10203569 3300031911 Bacteria 1505
87 Ga0307409_100009448 3300031995 Bacteria 5991
88 Ga0307409_100075366 3300031995 Bacteria 2701
89 Ga0307409_100110989 3300031995 Bacteria 2299
90 Ga0307409_100705536 3300031995 Bacteria 1009
91 Ga0307416_100002007 3300032002 Bacteria 11438
92 Ga0307416_100287660 3300032002 Bacteria 1625
93 Ga0307416_100346032 3300032002 Bacteria 1502
94 Ga0307411_10315962 3300032005 Bacteria 1259
95 Ga0307415_100036342 3300032126 Bacteria 3226
96 Ga0307415_100065454 3300032126 Bacteria 2533
97 Ga0307415_100237739 3300032126 Bacteria 1471
98 Ga0307415_100507843 3300032126 Bacteria 1055
99 Ga0373947_0196660 3300035725 Bacteria 1318
100 Ga0373937_0469640 3300036401 Bacteria 1195
101 Ga0395900_0555480 3300037418 Bacteria 1092
102 Ga0395898_0402545 3300037466 Bacteria 1305
103 Ga0436364_0697446 3300037853 Bacteria 2166
104 Ga0395901_0209405 3300038443 Bacteria 2041
105 Ga0436365_1063899 3300039437 Bacteria 4378
106 Ga0436365_1857972 3300039437 Bacteria 4477
107 Ga0436362_0226126 3300039453 Bacteria 2237
108 Ga0451837_1339321 3300041494 Bacteria 1605
109 Ga0451853_1955338 3300041512 Bacteria 739
110 Ga0439464_0051563 3300042439 Bacteria 1191
111 Ga0466969_0038480 3300044656 Bacteria 2407
112 Ga0466969_0079666 3300044656 Bacteria 1565
113 Ga0466965_0030582 3300044683 Bacteria 2624
114 Ga0466966_0013788 3300044684 Bacteria 5348
115 Ga0466961_0029492 3300044693 Bacteria 3526
116 Ga0466961_0036963 3300044693 Bacteria 3134
117 Ga0466963_0044007 3300044694 Bacteria 2937
118 Ga0466963_0058146 3300044694 Bacteria 2577
119 Ga0466971_0031844 3300044719 Bacteria 2362
120 Ga0466970_0080059 3300044765 Bacteria 1765
121 Ga0466957_0024534 3300044842 Bacteria 3569
122 Ga0466959_0009193 3300045049 Bacteria 7018
123 Ga0466959_0017078 3300045049 Bacteria 5314
124 Ga0466959_0262383 3300045049 Bacteria 1189
125 Ga0466958_0113002 3300045836 Bacteria 1696
126 Ga0466958_0162796 3300045836 Bacteria 1410
127 Ga0466967_0013482 3300045976 Bacteria 6319
128 Ga0466967_0054592 3300045976 Bacteria 3517
129 Ga0466967_0075907 3300045976 Bacteria 3022
130 Ga0466967_0164367 3300045976 Bacteria 2085
131 Ga0466967_0250129 3300045976 Bacteria 1693
132 Ga0466967_0307431 3300045976 Bacteria 1526
133 Ga0466967_0630951 3300045976 Bacteria 1059
134 Ga0466967_0995723 3300045976 Bacteria 834
135 Ga0495620_0063717 3300046515 Bacteria 1527
136 Ga0495652_0074435 3300046529 Bacteria 2824
137 Ga0495640_0271082 3300046533 Unclassified 1058
138 Ga0495668_0103248 3300046616 Bacteria 1560
139 Ga0495657_0104037 3300046675 Bacteria 1806
140 Ga0495658_0051104 3300046683 Bacteria 2341
141 Ga0495604_0019582 3300047317 Bacteria 5417
142 Ga0496121_0033997 3300048924 Bacteria 4599
143 Ga0501031_0140787 3300049568 Bacteria 1577
144 Ga0501031_0162154 3300049568 Bacteria 1461
145 Ga0501038_0481003 3300049574 Bacteria 952
146 Ga0501039_0012293 3300049575 Bacteria 6528
147 Ga0501039_0046681 3300049575 Bacteria 3347
148 Ga0501041_0081439 3300049577 Bacteria 1993
149 Ga0501042_0047570 3300049578 Bacteria 3059
150 Ga0501042_0260732 3300049578 Bacteria 1251
151 Ga0501048_0043325 3300049582 Bacteria 3222
152 Ga0501071_0033640 3300049587 Bacteria 3642
153 Ga0501076_0016737 3300049592 Bacteria 5563
154 Ga0501076_0083712 3300049592 Bacteria 2562
155 Ga0501076_0281882 3300049592 Bacteria 1361
156 Ga0501077_0660463 3300049593 Bacteria 672
157 Ga0501079_0312658 3300049741 Bacteria 1229
158 Ga0501080_0567884 3300049742 Bacteria 1009
159 nmdc:mga0qj67_14454_c1 3300050509 Bacteria 5969
160 nmdc:mga0qj67_163104_c1 3300050509 Unclassified 1809
161 nmdc:mga06r32_23356_c1 3300050510 Bacteria 5720
162 nmdc:mga06r32_3294_c1 3300050510 Bacteria 14466
163 Ga0501084_0072946 3300054114 Bacteria 2875
164 Ga0501084_0235427 3300054114 Bacteria 1546
165 Ga0501082_1234653 3300060353 Bacteria 653
166 Ga0466962_0150385 3300061719 Bacteria 1129
167 Ga0530510_0092891 3300061734 Bacteria 2202
168 Ga0530510_0509578 3300061734 Bacteria 912
169 Ga0495667_0345569
170 JGI25407J50210_10006874
171 Ga0070683_100139160
172 Ga0070683_100392325
173 Ga0070682_100305636
174 Ga0070660_100074057
175 Ga0070660_100268665
176 Ga0070689_100328068
177 Ga0070671_100707663
178 Ga0070674_100198500
179 Ga0070674_100569271
180 Ga0070673_100355645
181 Ga0070713_100070615
182 Ga0070713_100514940
183 Ga0070700_100238967
184 Ga0070662_100094714
185 Ga0070662_100631032
186 Ga0070684_100128494
187 Ga0070684_100136155
188 Ga0070672_100250641
189 Ga0070693_100202174
190 Ga0070664_100035466
191 Ga0070664_100111593
192 Ga0070664_100306991
193 Ga0068856_100015972
194 Ga0068862_100145671
195 Ga0081455_10015378
196 Ga0081455_10188608
197 Ga0081538_10000070
198 Ga0081538_10000309
199 Ga0081538_10001142
200 Ga0081538_10006733
201 Ga0081538_10009578
202 Ga0081538_10011562
203 Ga0081538_10012809
204 Ga0081538_10033405
205 Ga0081539_10009796
206 Ga0070717_10031153
207 Ga0075365_10043193
208 Ga0075365_10390405
209 Ga0075363_100038102
210 Ga0075430_100027715
211 Ga0075431_100021435
212 Ga0105240_10029641
213 Ga0111539_10615876
214 Ga0114129_10463251
215 Ga0105237_10000540
216 Ga0105238_11058532
217 Ga0105239_11456986
218 Ga0157380_10225746
219 Ga0157379_10010795
220 Ga0213876_10013614
221 Ga0213875_10236738
222 Ga0207647_10084414
223 Ga0207695_10039644
224 Ga0207671_10002417
225 Ga0207657_10368822
226 Ga0207700_10042651
227 Ga0207700_10677093
228 Ga0207664_10403090
229 Ga0207690_10284131
230 Ga0207706_10215687
231 Ga0207669_10203633
232 Ga0207669_10341944
233 Ga0207691_10069524
234 Ga0207661_10044252
235 Ga0207661_10194026
236 Ga0207679_10105645
237 Ga0207679_10217933
238 Ga0207679_10276593
239 Ga0207702_10011614
240 Ga0207676_10184306
241 Ga0207698_10690168
242 Ga0265338_10007092
243 Ga0265327_10015719
244 Ga0265327_10030382
245 Ga0307413_10026358
246 Ga0307410_10184441
247 Ga0307406_10008461
248 Ga0307406_10018392
249 Ga0307406_10054562
250 Ga0307407_10033963
251 Ga0307407_10141444
252 Ga0307407_10196701
253 Ga0307407_10505564
254 Ga0307412_10203569
255 Ga0307409_100009448
256 Ga0307409_100075366
257 Ga0307409_100110989
258 Ga0307409_100705536
259 Ga0307416_100002007
260 Ga0307416_100287660
261 Ga0307416_100346032
262 Ga0307411_10315962
263 Ga0307415_100036342
264 Ga0307415_100065454
265 Ga0307415_100237739
266 Ga0307415_100507843
267 Ga0373947_0196660
268 Ga0373937_0469640
269 Ga0395900_0555480
270 Ga0395898_0402545
271 Ga0436364_0697446
272 Ga0395901_0209405
273 Ga0436365_1063899
274 Ga0436365_1857972
275 Ga0436362_0226126
276 Ga0451837_1339321
277 Ga0451853_1955338
278 Ga0439464_0051563
279 Ga0466969_0038480
280 Ga0466969_0079666
281 Ga0466965_0030582
282 Ga0466966_0013788
283 Ga0466961_0029492
284 Ga0466961_0036963
285 Ga0466963_0044007
286 Ga0466963_0058146
287 Ga0466971_0031844
288 Ga0466970_0080059
289 Ga0466957_0024534
290 Ga0466959_0009193
291 Ga0466959_0017078
292 Ga0466959_0262383
293 Ga0466958_0113002
294 Ga0466958_0162796
295 Ga0466967_0013482
296 Ga0466967_0054592
297 Ga0466967_0075907
298 Ga0466967_0164367
299 Ga0466967_0250129
300 Ga0466967_0307431
301 Ga0466967_0630951
302 Ga0466967_0995723
303 Ga0495620_0063717
304 Ga0495652_0074435
305 Ga0495640_0271082
306 Ga0495668_0103248
307 Ga0495657_0104037
308 Ga0495658_0051104
309 Ga0495604_0019582
310 Ga0496121_0033997
311 Ga0501031_0140787
312 Ga0501031_0162154
313 Ga0501038_0481003
314 Ga0501039_0012293
315 Ga0501039_0046681
316 Ga0501041_0081439
317 Ga0501042_0047570
318 Ga0501042_0260732
319 Ga0501048_0043325
320 Ga0501071_0033640
321 Ga0501076_0016737
322 Ga0501076_0083712
323 Ga0501076_0281882
324 Ga0501077_0660463
325 Ga0501079_0312658
326 Ga0501080_0567884
327 nmdc:mga0qj67_14454_c1
328 nmdc:mga0qj67_163104_c1
329 nmdc:mga06r32_23356_c1
330 nmdc:mga06r32_3294_c1
331 Ga0501084_0072946
332 Ga0501084_0235427
333 Ga0501082_1234653
334 Ga0466962_0150385
335 Ga0530510_0092891
336 Ga0530510_0509578

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03009

GDPD

Glycerophosphoryl diester phosphodiesterase family

36

87

0.95

PF03009

GDPD

Glycerophosphoryl diester phosphodiesterase family

108

258

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
5t9c-assembly1.cif.gz_E crystal structure of b. subtilis 168 glpq in complex with glycerol-3-phosphate (1 hour soak) 0.8 1 225
5t91-assembly1.cif.gz_A crystal structure of b. subtilis 168 glpq in complex with bicine 0.7988 1 225
5t9b-assembly1.cif.gz_G crystal structure of b. subtilis 168 glpq in complex with glycerol-3-phosphate (5 minute soak) 0.7985 1 225
5t9c-assembly1.cif.gz_E crystal structure of b. subtilis 168 glpq in complex with glycerol-3-phosphate (1 hour soak) 0.7932 1 225
5t91-assembly1.cif.gz_A crystal structure of b. subtilis 168 glpq in complex with bicine 0.7921 1 225
ID Description Score Start End Superfamily
af_A0A0P0XM87_357_553_3.20.20.190 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.8942 1 49 3.20.20.190
af_Q9VEU9_80_321_3.20.20.190 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.7953 3 223 3.20.20.190
af_A0A1D6PRB6_164_362_3.20.20.190 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.7854 54 224 3.20.20.190
af_Q23244_121_373_3.20.20.190 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.7832 5 223 3.20.20.190
af_Q9VEU9_80_321_3.20.20.190 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.7757 3 223 3.20.20.190
ID Description Score Start End GO Terms
AF-A0A2W6BUY3-F1-model_v4 GP-PDE domain-containing protein 0.9891 1 110 GO:0006629
GO:0008081
AF-A0A7V8WB06-F1-model_v4 Glycerophosphodiester phosphodiesterase 0.985 1 226 GO:0006629
GO:0008081
AF-A0A7V9GSJ3-F1-model_v4 Glycerophosphodiester phosphodiesterase 0.9811 1 226 GO:0006629
GO:0008081
AF-A0A7K0QLD4-F1-model_v4 GP-PDE domain-containing protein 0.9809 1 226 GO:0006629
GO:0008081
AF-A0A7V8WB06-F1-model_v4 Glycerophosphodiester phosphodiesterase 0.9807 1 226 GO:0006629
GO:0008081

Map