F253230

General Info

Members Datasets Scaffolds Average Seq Length
168 103 336 143

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0619389|Ga0466967_0619389_394_834
Length 135
Sequence MSAVEDGTTRARLDPDAGERFLALRRALGVSSFGMNQIVLQPGQRGRIHRHRAQEEVYLVLEGRLTLLELIRVAPQIRRQLVNRGPGRLVLLALGGAAEHQGRDGEAFTSWDDESPVSPQELPMPPDLDPGELRL

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
12 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
16 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
32 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
33 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
34 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
35 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
36 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
49 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
50 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
51 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
52 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
53 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
54 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
55 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
56 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
57 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
58 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
59 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
60 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
61 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
62 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
63 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
64 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
65 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
66 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
67 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
68 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
69 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
70 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
71 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
72 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
73 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
74 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
75 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
76 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
77 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
78 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
79 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
80 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
81 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
82 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
83 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
84 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
85 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
86 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
87 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
88 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
89 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
90 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
91 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
92 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
93 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
94 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
95 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
96 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
97 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
98 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
99 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
100 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
101 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
102 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
103 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.33
Nodule 0
Rhizoplane 17.86
Rhizosphere 56.55
Stem 0
Stem Tuber 0
Unclassified 10.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0619389 3300045976 Bacteria 1069
2 Ga0070690_100620984 3300005330 Bacteria 822
3 Ga0070689_101795325 3300005340 Bacteria 559
4 Ga0070671_101739977 3300005355 Bacteria 553
5 Ga0070709_10070396 3300005434 Bacteria 2254
6 Ga0070714_100033558 3300005435 Bacteria 4291
7 Ga0070714_100427314 3300005435 Bacteria 1256
8 Ga0070713_100130497 3300005436 Bacteria 2215
9 Ga0070711_100103035 3300005439 Unclassified 2079
10 Ga0070678_101381456 3300005456 Bacteria 657
11 Ga0070684_101469151 3300005535 Bacteria 642
12 Ga0070704_101956200 3300005549 Bacteria 544
13 Ga0068854_101134016 3300005578 Bacteria 698
14 Ga0068856_101412277 3300005614 Bacteria 710
15 Ga0068859_101004228 3300005617 Unclassified 916
16 Ga0068864_100337952 3300005618 Bacteria 1418
17 Ga0068861_102043891 3300005719 Bacteria 572
18 Ga0068863_101490171 3300005841 Unclassified 685
19 Ga0070717_11316494 3300006028 Unclassified 657
20 Ga0075365_10258451 3300006038 Bacteria 1224
21 Ga0075365_10865009 3300006038 Bacteria 638
22 Ga0075368_10138959 3300006042 Bacteria 1012
23 Ga0075368_10183355 3300006042 Bacteria 883
24 Ga0075363_100206847 3300006048 Bacteria 1122
25 Ga0075364_10080928 3300006051 Bacteria 2147
26 Ga0075364_10304327 3300006051 Bacteria 1085
27 Ga0070716_100033529 3300006173 Bacteria 2809
28 Ga0070712_100114287 3300006175 Bacteria 2021
29 Ga0070712_100147975 3300006175 Unclassified 1800
30 Ga0075367_10471946 3300006178 Bacteria 795
31 Ga0075367_10657162 3300006178 Bacteria 666
32 Ga0097620_101004209 3300006931 Unclassified 916
33 Ga0111539_11254383 3300009094 Bacteria 860
34 Ga0105245_11496459 3300009098 Bacteria 726
35 Ga0114129_10059641 3300009147 Bacteria 5334
36 Ga0105243_11312102 3300009148 Bacteria 741
37 Ga0157380_12209704 3300014326 Bacteria 614
38 Ga0213873_10080205 3300021358 Bacteria 912
39 Ga0213874_10012638 3300021377 Bacteria 2170
40 Ga0213874_10085852 3300021377 Bacteria 1026
41 Ga0213876_10014273 3300021384 Unclassified 4211
42 Ga0213876_10048825 3300021384 Bacteria 2235
43 Ga0213876_10054129 3300021384 Bacteria 2119
44 Ga0213876_10061259 3300021384 Bacteria 1985
45 Ga0213876_10137042 3300021384 Bacteria 1302
46 Ga0213875_10007821 3300021388 Bacteria 5493
47 Ga0213875_10022764 3300021388 Bacteria 2997
48 Ga0213875_10025175 3300021388 Bacteria 2836
49 Ga0213875_10041795 3300021388 Bacteria 2156
50 Ga0213875_10069536 3300021388 Bacteria 1644
51 Ga0207699_10050165 3300025906 Bacteria 2459
52 Ga0207693_10175329 3300025915 Bacteria 1687
53 Ga0207693_10442960 3300025915 Bacteria 1015
54 Ga0207693_11390068 3300025915 Bacteria 522
55 Ga0207663_10383761 3300025916 Unclassified 1071
56 Ga0207700_10000001 3300025928 Bacteria 1122509
57 Ga0207664_10133565 3300025929 Bacteria 2092
58 Ga0207664_10838624 3300025929 Bacteria 826
59 Ga0207709_10964880 3300025935 Bacteria 695
60 Ga0207670_11516268 3300025936 Bacteria 570
61 Ga0207665_10004897 3300025939 Bacteria 8923
62 Ga0207661_11220706 3300025944 Bacteria 692
63 Ga0207677_10321117 3300026023 Bacteria 1287
64 Ga0207702_10299679 3300026078 Bacteria 1525
65 Ga0207702_11826191 3300026078 Bacteria 600
66 Ga0207683_11229331 3300026121 Bacteria 694
67 Ga0209813_10120373 3300027866 Bacteria 913
68 Ga0307406_10952759 3300031901 Bacteria 734
69 Ga0307407_10288300 3300031903 Bacteria 1140
70 Ga0307409_102934340 3300031995 Bacteria 504
71 Ga0307415_100679076 3300032126 Bacteria 927
72 Ga0373937_0131284 3300036401 Bacteria 2340
73 Ga0395899_0005333 3300037312 Bacteria 9983
74 Ga0395899_0132000 3300037312 Bacteria 1782
75 Ga0395899_0206346 3300037312 Bacteria 1367
76 Ga0395900_0001311 3300037418 Bacteria 30204
77 Ga0395900_0014315 3300037418 Bacteria 8097
78 Ga0395898_0000635 3300037466 Bacteria 64060
79 Ga0395905_0001334 3300037471 Bacteria 30049
80 Ga0395905_1298428 3300037471 Unclassified 631
81 Ga0436364_0178957 3300037853 Bacteria 4939
82 Ga0436364_0211910 3300037853 Bacteria 2297
83 Ga0436364_0255314 3300037853 Bacteria 4768
84 Ga0436364_0677117 3300037853 Bacteria 5230
85 Ga0436364_0687531 3300037853 Bacteria 25095
86 Ga0436364_1547625 3300037853 Bacteria 3486
87 Ga0436364_1563655 3300037853 Unclassified 682
88 Ga0395901_0001474 3300038443 Bacteria 24475
89 Ga0395901_0639326 3300038443 Bacteria 1068
90 Ga0395901_1140537 3300038443 Unclassified 748
91 Ga0436365_0317807 3300039437 Bacteria 721
92 Ga0436365_0326633 3300039437 Bacteria 2323
93 Ga0436365_0501674 3300039437 Bacteria 21993
94 Ga0436365_0628089 3300039437 Bacteria 6506
95 Ga0436365_1379032 3300039437 Bacteria 6869
96 Ga0436365_1413117 3300039437 Bacteria 11935
97 Ga0436365_1627724 3300039437 Bacteria 2483
98 Ga0436360_1363194 3300039438 Bacteria 715
99 Ga0436363_0049142 3300039450 Bacteria 2225
100 Ga0436363_0371942 3300039450 Bacteria 1537
101 Ga0436363_0744401 3300039450 Unclassified 4039
102 Ga0436362_0191542 3300039453 Bacteria 3119
103 Ga0436362_0778835 3300039453 Bacteria 1821
104 Ga0451793_0044227 3300041452 Bacteria 520
105 Ga0466965_0611421 3300044683 Unclassified 620
106 Ga0466966_0467372 3300044684 Unclassified 758
107 Ga0466961_0202633 3300044693 Bacteria 1227
108 Ga0466961_0403273 3300044693 Bacteria 830
109 Ga0466963_0052291 3300044694 Bacteria 2710
110 Ga0466963_0972467 3300044694 Unclassified 598
111 Ga0466963_1252779 3300044694 Bacteria 521
112 Ga0466971_0155937 3300044719 Bacteria 1067
113 Ga0466968_0030123 3300044735 Bacteria 2247
114 Ga0466970_0462644 3300044765 Bacteria 728
115 Ga0466957_0577843 3300044842 Bacteria 785
116 Ga0466959_0103030 3300045049 Bacteria 2042
117 Ga0466959_0270864 3300045049 Bacteria 1167
118 Ga0466959_0472318 3300045049 Bacteria 849
119 Ga0466958_0009288 3300045836 Bacteria 5476
120 Ga0466958_0027894 3300045836 Bacteria 3344
121 Ga0466958_0157699 3300045836 Bacteria 1433
122 Ga0466958_0530758 3300045836 Unclassified 764
123 Ga0466967_0035393 3300045976 Bacteria 4251
124 Ga0466967_0879278 3300045976 Unclassified 891
125 Ga0495629_0221768 3300046459 Bacteria 1304
126 Ga0495605_0365464 3300046474 Bacteria 604
127 Ga0495584_0285977 3300046491 Bacteria 838
128 Ga0495585_0349372 3300046492 Bacteria 719
129 Ga0495620_0257786 3300046515 Bacteria 665
130 Ga0495589_0189408 3300046794 Bacteria 974
131 Ga0496100_0156329 3300048903 Bacteria 1631
132 Ga0496101_0863011 3300048904 Bacteria 713
133 Ga0496102_0015380 3300048905 Bacteria 6665
134 Ga0496102_0174167 3300048905 Bacteria 2026
135 Ga0496102_0415481 3300048905 Bacteria 1264
136 Ga0496103_0133215 3300048906 Bacteria 1588
137 Ga0496104_0169163 3300048907 Bacteria 2096
138 Ga0496105_0025728 3300048908 Bacteria 4794
139 Ga0496105_0640342 3300048908 Bacteria 821
140 Ga0496106_0098877 3300048909 Bacteria 2261
141 Ga0496107_0095020 3300048910 Unclassified 2181
142 Ga0496107_0558971 3300048910 Bacteria 847
143 Ga0496107_0577281 3300048910 Bacteria 832
144 Ga0496108_0001964 3300048911 Bacteria 16463
145 Ga0496108_0055407 3300048911 Bacteria 3329
146 Ga0496109_0004039 3300048912 Bacteria 12254
147 Ga0496109_0016208 3300048912 Bacteria 6513
148 Ga0496109_1810179 3300048912 Bacteria 544
149 Ga0496110_0014616 3300048913 Bacteria 6522
150 Ga0496110_0045147 3300048913 Bacteria 3850
151 Ga0496111_0065044 3300048914 Bacteria 2646
152 Ga0496111_0118698 3300048914 Bacteria 1953
153 Ga0496111_0200326 3300048914 Bacteria 1484
154 Ga0496111_0542067 3300048914 Bacteria 854
155 Ga0496112_0134873 3300048915 Bacteria 2439
156 Ga0496112_0377384 3300048915 Bacteria 1359
157 Ga0496113_0005502 3300048916 Bacteria 7906
158 Ga0496113_0056292 3300048916 Bacteria 2952
159 Ga0496115_1086805 3300048918 Bacteria 607
160 Ga0501031_0508955 3300049568 Bacteria 776
161 nmdc:mga03n38_191727_c1 3300050490 Bacteria 1053
162 nmdc:mga00v17_195575_c1 3300050491 Bacteria 1307
163 nmdc:mga06z11_323065_c1 3300050494 Bacteria 921
164 nmdc:mga06z11_606190_c1 3300050494 Bacteria 666
165 nmdc:mga05p37_101775_c1 3300050507 Bacteria 3537
166 nmdc:mga0qj67_701914_c1 3300050509 Archaea 805
167 Ga0495595_0581165 3300053084 Bacteria 573
168 Ga0466962_0026813 3300061719 Bacteria 2767
169 Ga0466967_0619389
170 Ga0070690_100620984
171 Ga0070689_101795325
172 Ga0070671_101739977
173 Ga0070709_10070396
174 Ga0070714_100033558
175 Ga0070714_100427314
176 Ga0070713_100130497
177 Ga0070711_100103035
178 Ga0070678_101381456
179 Ga0070684_101469151
180 Ga0070704_101956200
181 Ga0068854_101134016
182 Ga0068856_101412277
183 Ga0068859_101004228
184 Ga0068864_100337952
185 Ga0068861_102043891
186 Ga0068863_101490171
187 Ga0070717_11316494
188 Ga0075365_10258451
189 Ga0075365_10865009
190 Ga0075368_10138959
191 Ga0075368_10183355
192 Ga0075363_100206847
193 Ga0075364_10080928
194 Ga0075364_10304327
195 Ga0070716_100033529
196 Ga0070712_100114287
197 Ga0070712_100147975
198 Ga0075367_10471946
199 Ga0075367_10657162
200 Ga0097620_101004209
201 Ga0111539_11254383
202 Ga0105245_11496459
203 Ga0114129_10059641
204 Ga0105243_11312102
205 Ga0157380_12209704
206 Ga0213873_10080205
207 Ga0213874_10012638
208 Ga0213874_10085852
209 Ga0213876_10014273
210 Ga0213876_10048825
211 Ga0213876_10054129
212 Ga0213876_10061259
213 Ga0213876_10137042
214 Ga0213875_10007821
215 Ga0213875_10022764
216 Ga0213875_10025175
217 Ga0213875_10041795
218 Ga0213875_10069536
219 Ga0207699_10050165
220 Ga0207693_10175329
221 Ga0207693_10442960
222 Ga0207693_11390068
223 Ga0207663_10383761
224 Ga0207700_10000001
225 Ga0207664_10133565
226 Ga0207664_10838624
227 Ga0207709_10964880
228 Ga0207670_11516268
229 Ga0207665_10004897
230 Ga0207661_11220706
231 Ga0207677_10321117
232 Ga0207702_10299679
233 Ga0207702_11826191
234 Ga0207683_11229331
235 Ga0209813_10120373
236 Ga0307406_10952759
237 Ga0307407_10288300
238 Ga0307409_102934340
239 Ga0307415_100679076
240 Ga0373937_0131284
241 Ga0395899_0005333
242 Ga0395899_0132000
243 Ga0395899_0206346
244 Ga0395900_0001311
245 Ga0395900_0014315
246 Ga0395898_0000635
247 Ga0395905_0001334
248 Ga0395905_1298428
249 Ga0436364_0178957
250 Ga0436364_0211910
251 Ga0436364_0255314
252 Ga0436364_0677117
253 Ga0436364_0687531
254 Ga0436364_1547625
255 Ga0436364_1563655
256 Ga0395901_0001474
257 Ga0395901_0639326
258 Ga0395901_1140537
259 Ga0436365_0317807
260 Ga0436365_0326633
261 Ga0436365_0501674
262 Ga0436365_0628089
263 Ga0436365_1379032
264 Ga0436365_1413117
265 Ga0436365_1627724
266 Ga0436360_1363194
267 Ga0436363_0049142
268 Ga0436363_0371942
269 Ga0436363_0744401
270 Ga0436362_0191542
271 Ga0436362_0778835
272 Ga0451793_0044227
273 Ga0466965_0611421
274 Ga0466966_0467372
275 Ga0466961_0202633
276 Ga0466961_0403273
277 Ga0466963_0052291
278 Ga0466963_0972467
279 Ga0466963_1252779
280 Ga0466971_0155937
281 Ga0466968_0030123
282 Ga0466970_0462644
283 Ga0466957_0577843
284 Ga0466959_0103030
285 Ga0466959_0270864
286 Ga0466959_0472318
287 Ga0466958_0009288
288 Ga0466958_0027894
289 Ga0466958_0157699
290 Ga0466958_0530758
291 Ga0466967_0035393
292 Ga0466967_0879278
293 Ga0495629_0221768
294 Ga0495605_0365464
295 Ga0495584_0285977
296 Ga0495585_0349372
297 Ga0495620_0257786
298 Ga0495589_0189408
299 Ga0496100_0156329
300 Ga0496101_0863011
301 Ga0496102_0015380
302 Ga0496102_0174167
303 Ga0496102_0415481
304 Ga0496103_0133215
305 Ga0496104_0169163
306 Ga0496105_0025728
307 Ga0496105_0640342
308 Ga0496106_0098877
309 Ga0496107_0095020
310 Ga0496107_0558971
311 Ga0496107_0577281
312 Ga0496108_0001964
313 Ga0496108_0055407
314 Ga0496109_0004039
315 Ga0496109_0016208
316 Ga0496109_1810179
317 Ga0496110_0014616
318 Ga0496110_0045147
319 Ga0496111_0065044
320 Ga0496111_0118698
321 Ga0496111_0200326
322 Ga0496111_0542067
323 Ga0496112_0134873
324 Ga0496112_0377384
325 Ga0496113_0005502
326 Ga0496113_0056292
327 Ga0496115_1086805
328 Ga0501031_0508955
329 nmdc:mga03n38_191727_c1
330 nmdc:mga00v17_195575_c1
331 nmdc:mga06z11_323065_c1
332 nmdc:mga06z11_606190_c1
333 nmdc:mga05p37_101775_c1
334 nmdc:mga0qj67_701914_c1
335 Ga0495595_0581165
336 Ga0466962_0026813

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dct-assembly1.cif.gz_A crystal structure of the tt1209 from thermus thermophilus hb8 0.944 27 105
5wse-assembly1.cif.gz_D crystal structure of a cupin protein (tm1459) in osmium (os) substituted form i 0.942 27 104
3h8u-assembly1.cif.gz_B crystal structure of uncharacterized conserved protein with double-stranded beta-helix domain (yp_001338853.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.80 a resolution 0.9408 27 106
5wsf-assembly2.cif.gz_C crystal structure of a cupin protein (tm1459) in osmium (os)-substituted form ii 0.9408 27 104
4qm9-assembly2.cif.gz_B crystal structure of a putative cysteine dioxygenase from bacillus subtilis with cys-bound 0.9389 27 104
ID Description Score Start End Superfamily
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9456 30 103 2.60.120.10
2dctB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9392 27 105 2.60.120.10
af_P77626_84_178_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9334 28 104 2.60.120.10
af_Q2G2A6_62_177_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9301 29 105 2.60.120.10
3h8uB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9299 27 106 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7J9Z079-F1-model_v4 Cupin domain-containing protein 0.969 18 104 GO:0046872
AF-A0A840UXV9-F1-model_v4 Putative cupin superfamily protein 0.9673 18 105 GO:0046872
AF-S3KZB4-F1-model_v4 deleted 0.9505 29 116
AF-A0A6I6GVP9-F1-model_v4 Cupin domain-containing protein 0.9443 27 116
AF-W0F145-F1-model_v4 Cupin 0.943 27 116

Map