F253201

General Info

Members Datasets Scaffolds Average Seq Length
168 77 336 323

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0154170|Ga0453684_0154170_878_1984
Length 368
Sequence MARHAARFTEFSGVPDWRLSSPVPGLEPKTNMKKAKSTQKVAAKRGRLYVHSKAGTRKGSKGLSRAYDLRFRATPDYVAELPDVVHAPEEIQGSRVPIQQVGVSNFRLPLRYRTATGRTVVLETRVTGTVSLEAEHKGINMGRIVRSFYEGRGAVFSLERLGRVLEGYRRDVGSLSARLRLAFEYPMVQHALRSGLSGFQYYTVVLEGRLDANGVFHRFMEFDFVYSSACPCSSELAEHARSERGIFAVPHSQRSRAHVRVELAKGARLSVEDMQLHCLRALRTETQVMVKREDEQAFAELNGAELKFVEDAARLLHRELDADRRIADFQAVCAHFESLHSHDAVSVICKGVEGGLSAEFNDFRGLLC

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
9 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
10 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
11 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
12 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
13 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
14 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
15 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
16 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
17 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
25 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
26 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
27 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
28 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
29 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
30 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
31 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
32 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
33 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
34 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
35 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
36 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
37 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
38 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
39 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
40 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
41 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
42 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
43 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
44 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
45 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
46 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
47 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
48 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
49 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
50 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
51 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
52 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
53 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
54 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
55 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
56 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
57 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
58 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
59 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
60 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
61 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
62 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
63 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
64 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
65 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
66 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
69 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
70 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
72 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
73 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
74 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
76 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
77 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0
Isolates 0.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.6
Nodule 0
Rhizoplane 0
Rhizosphere 95.24
Stem 0
Stem Tuber 0
Unclassified 1.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0154170 3300044712 Bacteria 2726
2 rootH2_10013600 3300003320 Bacteria 23593
3 rootL2_10077791 3300003322 Bacteria 4398
4 Ga0070658_10006515 3300005327 Bacteria 9470
5 Ga0070658_10090296 3300005327 Bacteria 2524
6 Ga0068869_100000047 3300005334 Bacteria 51131
7 Ga0068868_100013864 3300005338 Bacteria 5925
8 Ga0068868_100102360 3300005338 Bacteria 2319
9 Ga0070713_100003642 3300005436 Bacteria 10194
10 Ga0068867_100001561 3300005459 Bacteria 15899
11 Ga0068857_100017492 3300005577 Bacteria 6283
12 Ga0068857_100126492 3300005577 Viruses 2303
13 Ga0097621_100014785 3300006237 Bacteria 5852
14 Ga0068871_100007823 3300006358 Bacteria 7658
15 Ga0068865_100000973 3300006881 Bacteria 16369
16 Ga0105238_10341611 3300009551 Viruses 1485
17 Ga0105239_10028422 3300010375 Bacteria 6151
18 Ga0157369_10103487 3300013105 Bacteria 3033
19 Ga0213876_10013215 3300021384 Bacteria 4388
20 Ga0207705_10189869 3300025909 Bacteria 1553
21 Ga0207700_10039289 3300025928 Bacteria 3444
22 Ga0207704_10001773 3300025938 Bacteria 9664
23 Ga0207661_10040826 3300025944 Bacteria 3650
24 Ga0207702_10001679 3300026078 Bacteria 21861
25 Ga0207702_10112936 3300026078 Bacteria 2419
26 Ga0207648_10008934 3300026089 Bacteria 9641
27 Ga0207674_10025243 3300026116 Bacteria 6341
28 Ga0207674_10174171 3300026116 Viruses 2104
29 Ga0265337_1010057 3300028556 Bacteria 3335
30 Ga0265337_1018286 3300028556 Bacteria 2229
31 Ga0265319_1000072 3300028563 Bacteria 81225
32 Ga0265319_1001375 3300028563 Bacteria 14636
33 Ga0265319_1002404 3300028563 Bacteria 10277
34 Ga0265319_1009060 3300028563 Bacteria 4289
35 Ga0265319_1013851 3300028563 Bacteria 3187
36 Ga0265319_1014618 3300028563 Bacteria 3073
37 Ga0265334_10000731 3300028573 Bacteria 16497
38 Ga0265334_10000838 3300028573 Bacteria 15354
39 Ga0265318_10000004 3300028577 Bacteria 319325
40 Ga0265318_10000377 3300028577 Bacteria 34827
41 Ga0265318_10006376 3300028577 Bacteria 5434
42 Ga0265318_10016591 3300028577 Bacteria 3041
43 Ga0265318_10038313 3300028577 Bacteria 1833
44 Ga0265318_10053482 3300028577 Bacteria 1514
45 Ga0265323_10000003 3300028653 Bacteria 200487
46 Ga0265323_10001295 3300028653 Bacteria 12489
47 Ga0265323_10002793 3300028653 Bacteria 7856
48 Ga0265323_10004190 3300028653 Bacteria 6244
49 Ga0265323_10010458 3300028653 Unclassified 3764
50 Ga0265323_10019036 3300028653 Bacteria 2652
51 Ga0265323_10025979 3300028653 Bacteria 2211
52 Ga0265323_10037989 3300028653 Bacteria 1762
53 Ga0265323_10051440 3300028653 Bacteria 1461
54 Ga0265322_10001346 3300028654 Bacteria 8156
55 Ga0265336_10000671 3300028666 Bacteria 18556
56 Ga0265336_10014424 3300028666 Bacteria 2619
57 Ga0307515_10089325 3300028794 Bacteria 3881
58 Ga0265338_10000201 3300028800 Bacteria 112868
59 Ga0265338_10000653 3300028800 Bacteria 59925
60 Ga0265338_10023687 3300028800 Bacteria 6299
61 Ga0265324_10000485 3300029957 Bacteria 27807
62 Ga0265324_10014659 3300029957 Bacteria 2895
63 Ga0265324_10038525 3300029957 Bacteria 1658
64 Ga0265330_10059811 3300031235 Unclassified 1659
65 Ga0265332_10039048 3300031238 Bacteria 2056
66 Ga0265332_10081858 3300031238 Bacteria 1369
67 Ga0265332_10082634 3300031238 Bacteria 1362
68 Ga0265320_10001981 3300031240 Bacteria 14455
69 Ga0265320_10003919 3300031240 Bacteria 9836
70 Ga0265320_10004424 3300031240 Bacteria 9212
71 Ga0265320_10006564 3300031240 Bacteria 7320
72 Ga0265320_10026670 3300031240 Bacteria 3020
73 Ga0265320_10042619 3300031240 Bacteria 2250
74 Ga0265325_10017145 3300031241 Bacteria 4030
75 Ga0265329_10022910 3300031242 Bacteria 2085
76 Ga0265340_10097313 3300031247 Bacteria 1370
77 Ga0265331_10006105 3300031250 Bacteria 7169
78 Ga0265331_10010510 3300031250 Bacteria 5119
79 Ga0265327_10000305 3300031251 Bacteria 95294
80 Ga0265327_10000380 3300031251 Bacteria 83657
81 Ga0265327_10004558 3300031251 Bacteria 12209
82 Ga0265327_10004955 3300031251 Bacteria 11445
83 Ga0265327_10007051 3300031251 Bacteria 8803
84 Ga0265327_10032050 3300031251 Bacteria 2946
85 Ga0265327_10034519 3300031251 Bacteria 2806
86 Ga0265327_10110956 3300031251 Bacteria 1311
87 Ga0265316_10003297 3300031344 Bacteria 16377
88 Ga0265316_10021808 3300031344 Bacteria 5414
89 Ga0265316_10040477 3300031344 Bacteria 3736
90 Ga0265316_10048525 3300031344 Bacteria 3350
91 Ga0265316_10223632 3300031344 Bacteria 1388
92 Ga0265316_10250165 3300031344 Bacteria 1301
93 Ga0265313_10003437 3300031595 Bacteria 12818
94 Ga0265313_10004434 3300031595 Bacteria 10805
95 Ga0265313_10013947 3300031595 Bacteria 4783
96 Ga0265313_10032368 3300031595 Bacteria 2670
97 Ga0307508_10000236 3300031616 Bacteria 67236
98 Ga0265314_10002646 3300031711 Bacteria 18000
99 Ga0265314_10005176 3300031711 Bacteria 11843
100 Ga0265314_10026938 3300031711 Bacteria 4312
101 Ga0265314_10033761 3300031711 Bacteria 3745
102 Ga0265314_10089314 3300031711 Bacteria 2010
103 Ga0265342_10016422 3300031712 Bacteria 4840
104 Ga0265342_10030904 3300031712 Bacteria 3315
105 Ga0265342_10031583 3300031712 Bacteria 3273
106 Ga0265342_10154980 3300031712 Bacteria 1269
107 Ga0307410_10000052 3300031852 Bacteria 41078
108 Ga0307409_100000102 3300031995 Bacteria 31115
109 Ga0373951_0010380 3300035091 Bacteria 2090
110 Ga0395905_0000064 3300037471 Bacteria 186494
111 Ga0436365_1418787 3300039437 Bacteria 51993
112 Ga0451577_0000541 3300042876 Bacteria 62102
113 Ga0451577_0029343 3300042876 Bacteria 4971
114 Ga0451577_0034625 3300042876 Bacteria 4551
115 Ga0451577_0044781 3300042876 Bacteria 3961
116 Ga0451577_0144815 3300042876 Bacteria 2136
117 Ga0451577_0505615 3300042876 Bacteria 1097
118 Ga0466969_0066987 3300044656 Bacteria 1733
119 Ga0453683_0018462 3300044673 Bacteria 4477
120 Ga0453683_0085659 3300044673 Bacteria 1974
121 Ga0453684_0000001 3300044712 Bacteria 2623166
122 Ga0453684_0054239 3300044712 Bacteria 5224
123 Ga0453684_0080280 3300044712 Bacteria 4074
124 Ga0453684_0296447 3300044712 Bacteria 1839
125 Ga0466968_0115599 3300044735 Bacteria 1210
126 Ga0466959_0048968 3300045049 Bacteria 3104
127 Ga0451576_0000794 3300045051 Bacteria 61984
128 Ga0451576_0000807 3300045051 Bacteria 61371
129 Ga0451576_0002152 3300045051 Bacteria 30499
130 Ga0451576_0018509 3300045051 Bacteria 7633
131 Ga0451576_0187770 3300045051 Bacteria 2158
132 Ga0451576_0226247 3300045051 Bacteria 1953
133 Ga0451576_0232745 3300045051 Bacteria 1924
134 Ga0466967_0103794 3300045976 Bacteria 2601
135 Ga0501031_0014986 3300049568 Bacteria 5036
136 Ga0501032_0000884 3300049569 Bacteria 24301
137 Ga0501032_0005495 3300049569 Bacteria 9403
138 Ga0501033_0004475 3300049570 Bacteria 11179
139 Ga0501033_0056373 3300049570 Bacteria 2904
140 Ga0501034_0014808 3300049571 Bacteria 8023
141 Ga0501034_0020512 3300049571 Bacteria 6748
142 Ga0501036_0003153 3300049572 Bacteria 13151
143 Ga0501036_0018003 3300049572 Bacteria 5915
144 Ga0501037_0009035 3300049573 Bacteria 7304
145 Ga0501038_0000930 3300049574 Bacteria 26054
146 Ga0501039_0040277 3300049575 Bacteria 3607
147 Ga0501043_0005910 3300049579 Bacteria 9845
148 Ga0501043_0021405 3300049579 Bacteria 5069
149 Ga0501046_0005096 3300049580 Bacteria 11788
150 Ga0501046_0025015 3300049580 Bacteria 4890
151 Ga0501046_0056634 3300049580 Bacteria 3076
152 Ga0501046_0098088 3300049580 Bacteria 2250
153 Ga0501047_0006701 3300049581 Bacteria 10828
154 Ga0501047_0103707 3300049581 Bacteria 2724
155 Ga0501047_0264746 3300049581 Bacteria 1566
156 Ga0501048_0213666 3300049582 Bacteria 1368
157 Ga0501243_002716 3300049675 Bacteria 2605
158 Ga0501080_0219228 3300049742 Bacteria 1741
159 Ga0501083_0007837 3300049744 Bacteria 7566
160 Ga0501083_0015412 3300049744 Bacteria 5353
161 Ga0501035_0000271 3300049822 Bacteria 61480
162 Ga0501035_0009872 3300049822 Bacteria 8861
163 Ga0501035_0015013 3300049822 Bacteria 7148
164 Ga0501044_0000080 3300049823 Bacteria 116837
165 Ga0501044_0022363 3300049823 Bacteria 6739
166 Ga0501044_0389064 3300049823 Bacteria 1308
167 Ga0500568_0008896 3300053139 Bacteria 4804
168 2788433340 2786546940 Bacteria 6396474
169 Ga0453684_0154170
170 rootH2_10013600
171 rootL2_10077791
172 Ga0070658_10006515
173 Ga0070658_10090296
174 Ga0068869_100000047
175 Ga0068868_100013864
176 Ga0068868_100102360
177 Ga0070713_100003642
178 Ga0068867_100001561
179 Ga0068857_100017492
180 Ga0068857_100126492
181 Ga0097621_100014785
182 Ga0068871_100007823
183 Ga0068865_100000973
184 Ga0105238_10341611
185 Ga0105239_10028422
186 Ga0157369_10103487
187 Ga0213876_10013215
188 Ga0207705_10189869
189 Ga0207700_10039289
190 Ga0207704_10001773
191 Ga0207661_10040826
192 Ga0207702_10001679
193 Ga0207702_10112936
194 Ga0207648_10008934
195 Ga0207674_10025243
196 Ga0207674_10174171
197 Ga0265337_1010057
198 Ga0265337_1018286
199 Ga0265319_1000072
200 Ga0265319_1001375
201 Ga0265319_1002404
202 Ga0265319_1009060
203 Ga0265319_1013851
204 Ga0265319_1014618
205 Ga0265334_10000731
206 Ga0265334_10000838
207 Ga0265318_10000004
208 Ga0265318_10000377
209 Ga0265318_10006376
210 Ga0265318_10016591
211 Ga0265318_10038313
212 Ga0265318_10053482
213 Ga0265323_10000003
214 Ga0265323_10001295
215 Ga0265323_10002793
216 Ga0265323_10004190
217 Ga0265323_10010458
218 Ga0265323_10019036
219 Ga0265323_10025979
220 Ga0265323_10037989
221 Ga0265323_10051440
222 Ga0265322_10001346
223 Ga0265336_10000671
224 Ga0265336_10014424
225 Ga0307515_10089325
226 Ga0265338_10000201
227 Ga0265338_10000653
228 Ga0265338_10023687
229 Ga0265324_10000485
230 Ga0265324_10014659
231 Ga0265324_10038525
232 Ga0265330_10059811
233 Ga0265332_10039048
234 Ga0265332_10081858
235 Ga0265332_10082634
236 Ga0265320_10001981
237 Ga0265320_10003919
238 Ga0265320_10004424
239 Ga0265320_10006564
240 Ga0265320_10026670
241 Ga0265320_10042619
242 Ga0265325_10017145
243 Ga0265329_10022910
244 Ga0265340_10097313
245 Ga0265331_10006105
246 Ga0265331_10010510
247 Ga0265327_10000305
248 Ga0265327_10000380
249 Ga0265327_10004558
250 Ga0265327_10004955
251 Ga0265327_10007051
252 Ga0265327_10032050
253 Ga0265327_10034519
254 Ga0265327_10110956
255 Ga0265316_10003297
256 Ga0265316_10021808
257 Ga0265316_10040477
258 Ga0265316_10048525
259 Ga0265316_10223632
260 Ga0265316_10250165
261 Ga0265313_10003437
262 Ga0265313_10004434
263 Ga0265313_10013947
264 Ga0265313_10032368
265 Ga0307508_10000236
266 Ga0265314_10002646
267 Ga0265314_10005176
268 Ga0265314_10026938
269 Ga0265314_10033761
270 Ga0265314_10089314
271 Ga0265342_10016422
272 Ga0265342_10030904
273 Ga0265342_10031583
274 Ga0265342_10154980
275 Ga0307410_10000052
276 Ga0307409_100000102
277 Ga0373951_0010380
278 Ga0395905_0000064
279 Ga0436365_1418787
280 Ga0451577_0000541
281 Ga0451577_0029343
282 Ga0451577_0034625
283 Ga0451577_0044781
284 Ga0451577_0144815
285 Ga0451577_0505615
286 Ga0466969_0066987
287 Ga0453683_0018462
288 Ga0453683_0085659
289 Ga0453684_0000001
290 Ga0453684_0054239
291 Ga0453684_0080280
292 Ga0453684_0296447
293 Ga0466968_0115599
294 Ga0466959_0048968
295 Ga0451576_0000794
296 Ga0451576_0000807
297 Ga0451576_0002152
298 Ga0451576_0018509
299 Ga0451576_0187770
300 Ga0451576_0226247
301 Ga0451576_0232745
302 Ga0466967_0103794
303 Ga0501031_0014986
304 Ga0501032_0000884
305 Ga0501032_0005495
306 Ga0501033_0004475
307 Ga0501033_0056373
308 Ga0501034_0014808
309 Ga0501034_0020512
310 Ga0501036_0003153
311 Ga0501036_0018003
312 Ga0501037_0009035
313 Ga0501038_0000930
314 Ga0501039_0040277
315 Ga0501043_0005910
316 Ga0501043_0021405
317 Ga0501046_0005096
318 Ga0501046_0025015
319 Ga0501046_0056634
320 Ga0501046_0098088
321 Ga0501047_0006701
322 Ga0501047_0103707
323 Ga0501047_0264746
324 Ga0501048_0213666
325 Ga0501243_002716
326 Ga0501080_0219228
327 Ga0501083_0007837
328 Ga0501083_0015412
329 Ga0501035_0000271
330 Ga0501035_0009872
331 Ga0501035_0015013
332 Ga0501044_0000080
333 Ga0501044_0022363
334 Ga0501044_0389064
335 Ga0500568_0008896
336 2788433340

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02649

GCHY-1

Type I GTP cyclohydrolase folE2

81

346

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r5r-assembly1.cif.gz_A the crystal structure of duf198 from nitrosomonas europaea atcc 19718 0.9042 50 304
3d2o-assembly1.cif.gz_A crystal structure of manganese-metallated gtp cyclohydrolase type ib 0.8948 49 304
2r5r-assembly1.cif.gz_A the crystal structure of duf198 from nitrosomonas europaea atcc 19718 0.8912 50 304
3d2o-assembly1.cif.gz_A crystal structure of manganese-metallated gtp cyclohydrolase type ib 0.8847 49 304
5k95-assembly1.cif.gz_A crystal structure of gtp cyclohydrolase-ib with 8-oxo-gtp 0.8667 50 304
ID Description Score Start End Superfamily
3d2oB00 Alpha Beta;Roll;Urate Oxidase;Urate Oxidase; 0.9034 51 304 3.10.270.10
3d2oB00 Alpha Beta;Roll;Urate Oxidase;Urate Oxidase; 0.8896 51 304 3.10.270.10
af_Q58185_15_301_3.10.270.10 Alpha Beta;Roll;Urate Oxidase;Urate Oxidase; 0.8402 51 304 3.10.270.10
af_Q2G0L1_30_291_3.10.270.10 Alpha Beta;Roll;Urate Oxidase;Urate Oxidase; 0.8343 33 304 3.10.270.10
af_Q2G0L1_30_291_3.10.270.10 Alpha Beta;Roll;Urate Oxidase;Urate Oxidase; 0.8227 33 304 3.10.270.10
ID Description Score Start End GO Terms
AF-A0A6N6PNK8-F1-model_v4 deleted 0.9588 184 323
AF-A0A7C7DWG7-F1-model_v4 GTP cyclohydrolase I FolE2 0.9579 61 323 GO:0003934
AF-A0A357I3X1-F1-model_v4 GTP cyclohydrolase I FolE2 0.9562 163 321 GO:0003934
AF-A0A257LIU7-F1-model_v4 GTP cyclohydrolase I FolE2 0.9528 213 323 GO:0003934
AF-A0A6N6PNK8-F1-model_v4 deleted 0.9522 184 323

Map