F253105
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 168 | 129 | 336 | 317 |
Family's Representative Sequence
| Representative Sequence | 3300039437|Ga0436365_1776081|Ga0436365_1776081_5094_6269 |
| Length | 391 |
| Sequence | MRTKDRVAIGGNDMAAGKKRDGPRVVRRIFTLGLTLGEHAVCARIVEISFFPFATARYAAEKMMPSPAPEKNRVLVIGSFVQDLTWDCAEFPRAGETVIGRFRTGPGGKGSNQAVAAARAGARVTFVGGLGKDTFGDGAREFLRAEGIDCRAVEKSGVATGTAGILVNAHGQNEIVVALGASAALQPADLDAQMDIFKSAAVVLVQHEATLEVNAHALRRARAAGALTMLNPAPMRADFDPAILSSVDLLVPNETEFAALVNRLPDAAAKIGGEPFNETALAALDTAALQALCRCCGVPTVIITLGARGCFVSTSAGGELVPAVTDVRVVDTTGAGDAFAGALAAGLAEFGRGEVARAARFANVAAALSVTRVGTAPAMPRRAEIDALFSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 17 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 18 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 19 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 21 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 22 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 23 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 26 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 27 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 28 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 40 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 41 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 42 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 43 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 44 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 45 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 46 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 47 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 48 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 49 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 50 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 51 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 52 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 53 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 54 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 55 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 56 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 57 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 58 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 59 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 60 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 61 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 62 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 63 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 64 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 65 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 66 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 67 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 68 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 69 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 70 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 71 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 72 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 73 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 74 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 75 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 76 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 77 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 78 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 79 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 80 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 81 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 82 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 83 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 84 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 85 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 86 | 2786546940 | Opitutaceae bacterium EW11 | Isolate | Unclassified |
| 87 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 88 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 89 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 90 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 91 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 92 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 93 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 94 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 95 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 96 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 97 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 98 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 99 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 100 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 101 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 102 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 103 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 104 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 105 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 106 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 107 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 108 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 109 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 110 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 111 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 112 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 113 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 114 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 115 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 116 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 117 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 118 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 119 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 120 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 121 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 122 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 123 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 124 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 125 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 126 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 127 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 128 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 129 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 71.43 |
| Metatranscriptomes | 0 |
| Isolates | 28.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.55 |
| Nodule | 20.83 |
| Rhizoplane | 2.38 |
| Rhizosphere | 58.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.98 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0436365_1776081 | 3300039437 | Bacteria | 15207 |
| 2 | JGI25153J46596_10000035 | 3300003215 | Bacteria | 189737 |
| 3 | rootH2_10026431 | 3300003320 | Bacteria | 10117 |
| 4 | rootH2_10078987 | 3300003320 | Bacteria | 1868 |
| 5 | Ga0070683_100026886 | 3300005329 | Bacteria | 5187 |
| 6 | Ga0070660_100423046 | 3300005339 | Bacteria | 1103 |
| 7 | Ga0070668_100059040 | 3300005347 | Bacteria | 2969 |
| 8 | Ga0070668_100228540 | 3300005347 | Bacteria | 1537 |
| 9 | Ga0070667_100022717 | 3300005367 | Bacteria | 5201 |
| 10 | Ga0070667_100054259 | 3300005367 | Bacteria | 3384 |
| 11 | Ga0070713_100262043 | 3300005436 | Bacteria | 1580 |
| 12 | Ga0070708_100069823 | 3300005445 | Unclassified | 3159 |
| 13 | Ga0070706_100034159 | 3300005467 | Bacteria | 4696 |
| 14 | Ga0070707_100053743 | 3300005468 | Bacteria | 3862 |
| 15 | Ga0070698_100000225 | 3300005471 | Bacteria | 55661 |
| 16 | Ga0070699_100026281 | 3300005518 | Bacteria | 5021 |
| 17 | Ga0070697_100026509 | 3300005536 | Bacteria | 4631 |
| 18 | Ga0070665_100000065 | 3300005548 | Bacteria | 212975 |
| 19 | Ga0070665_100048213 | 3300005548 | Bacteria | 4277 |
| 20 | Ga0070665_100071035 | 3300005548 | Bacteria | 3488 |
| 21 | Ga0070665_100137344 | 3300005548 | Bacteria | 2448 |
| 22 | Ga0068859_100000547 | 3300005617 | Bacteria | 37255 |
| 23 | Ga0068851_10043944 | 3300005834 | Bacteria | 2253 |
| 24 | Ga0068862_100000290 | 3300005844 | Bacteria | 55379 |
| 25 | Ga0070717_10000003 | 3300006028 | Bacteria | 370103 |
| 26 | Ga0070717_10003966 | 3300006028 | Bacteria | 10651 |
| 27 | Ga0075365_10038368 | 3300006038 | Bacteria | 3113 |
| 28 | Ga0097620_100000547 | 3300006931 | Bacteria | 37255 |
| 29 | Ga0105240_10119541 | 3300009093 | Bacteria | 3174 |
| 30 | Ga0105240_10285615 | 3300009093 | Bacteria | 1894 |
| 31 | Ga0105240_10288016 | 3300009093 | Bacteria | 1884 |
| 32 | Ga0105248_10335822 | 3300009177 | Bacteria | 1702 |
| 33 | Ga0105239_10086693 | 3300010375 | Bacteria | 3451 |
| 34 | Ga0163163_10058762 | 3300014325 | Bacteria | 3803 |
| 35 | Ga0213876_10005216 | 3300021384 | Bacteria | 7161 |
| 36 | Ga0209758_1000028 | 3300025297 | Bacteria | 530102 |
| 37 | Ga0207656_10076445 | 3300025321 | Bacteria | 1498 |
| 38 | Ga0207684_10037441 | 3300025910 | Bacteria | 4116 |
| 39 | Ga0207695_10053757 | 3300025913 | Bacteria | 4209 |
| 40 | Ga0207671_10061414 | 3300025914 | Bacteria | 2788 |
| 41 | Ga0207646_10092106 | 3300025922 | Bacteria | 2713 |
| 42 | Ga0207644_10012896 | 3300025931 | Bacteria | 5556 |
| 43 | Ga0207661_10017415 | 3300025944 | Bacteria | 5317 |
| 44 | Ga0207678_10395754 | 3300026067 | Bacteria | 1196 |
| 45 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 46 | Ga0268265_10000136 | 3300028380 | Bacteria | 93413 |
| 47 | Ga0268264_10184109 | 3300028381 | Bacteria | 1899 |
| 48 | Ga0265319_1000040 | 3300028563 | Bacteria | 112246 |
| 49 | Ga0265319_1000264 | 3300028563 | Bacteria | 39616 |
| 50 | Ga0265319_1003672 | 3300028563 | Bacteria | 7915 |
| 51 | Ga0265319_1007457 | 3300028563 | Bacteria | 4918 |
| 52 | Ga0265319_1024633 | 3300028563 | Bacteria | 2163 |
| 53 | Ga0265334_10004923 | 3300028573 | Bacteria | 5870 |
| 54 | Ga0265318_10000034 | 3300028577 | Bacteria | 143153 |
| 55 | Ga0265318_10000088 | 3300028577 | Bacteria | 82498 |
| 56 | Ga0265318_10000301 | 3300028577 | Bacteria | 40135 |
| 57 | Ga0265318_10038046 | 3300028577 | Bacteria | 1841 |
| 58 | Ga0265318_10050402 | 3300028577 | Bacteria | 1564 |
| 59 | Ga0265338_10001729 | 3300028800 | Bacteria | 34551 |
| 60 | Ga0265338_10061944 | 3300028800 | Unclassified | 3275 |
| 61 | Ga0265324_10043604 | 3300029957 | Bacteria | 1547 |
| 62 | Ga0265320_10000451 | 3300031240 | Bacteria | 32255 |
| 63 | Ga0265320_10001523 | 3300031240 | Bacteria | 16816 |
| 64 | Ga0265320_10018775 | 3300031240 | Bacteria | 3798 |
| 65 | Ga0265320_10025104 | 3300031240 | Unclassified | 3139 |
| 66 | Ga0265320_10043571 | 3300031240 | Unclassified | 2217 |
| 67 | Ga0265339_10037368 | 3300031249 | Bacteria | 2714 |
| 68 | Ga0265331_10009345 | 3300031250 | Bacteria | 5508 |
| 69 | Ga0265331_10039117 | 3300031250 | Bacteria | 2314 |
| 70 | Ga0265327_10000281 | 3300031251 | Bacteria | 100389 |
| 71 | Ga0265327_10000631 | 3300031251 | Bacteria | 57438 |
| 72 | Ga0265327_10018195 | 3300031251 | Bacteria | 4366 |
| 73 | Ga0265316_10007918 | 3300031344 | Bacteria | 9941 |
| 74 | Ga0265316_10115477 | 3300031344 | Unclassified | 2030 |
| 75 | Ga0265316_10162267 | 3300031344 | Bacteria | 1670 |
| 76 | Ga0307513_10068360 | 3300031456 | Bacteria | 3722 |
| 77 | Ga0265313_10001077 | 3300031595 | Bacteria | 26378 |
| 78 | Ga0265313_10001253 | 3300031595 | Bacteria | 24176 |
| 79 | Ga0265313_10003769 | 3300031595 | Bacteria | 12027 |
| 80 | Ga0265313_10025603 | 3300031595 | Bacteria | 3121 |
| 81 | Ga0307508_10000044 | 3300031616 | Bacteria | 143750 |
| 82 | Ga0265314_10001495 | 3300031711 | Bacteria | 25964 |
| 83 | Ga0265314_10003144 | 3300031711 | Bacteria | 16196 |
| 84 | Ga0265314_10004607 | 3300031711 | Bacteria | 12717 |
| 85 | Ga0265314_10113776 | 3300031711 | Bacteria | 1715 |
| 86 | Ga0265342_10010309 | 3300031712 | Bacteria | 6498 |
| 87 | Ga0265342_10080280 | 3300031712 | Bacteria | 1885 |
| 88 | Ga0316578_10031194 | 3300031728 | Bacteria | 3035 |
| 89 | Ga0307516_10056913 | 3300031730 | Bacteria | 3811 |
| 90 | Ga0316580_10043435 | 3300032139 | Bacteria | 1387 |
| 91 | Ga0373931_0079946 | 3300035691 | Bacteria | 1802 |
| 92 | Ga0395905_0060441 | 3300037471 | Bacteria | 3543 |
| 93 | Ga0395905_0098162 | 3300037471 | Bacteria | 2751 |
| 94 | Ga0436365_0729669 | 3300039437 | Bacteria | 5459 |
| 95 | Ga0439445_0008716 | 3300042004 | Bacteria | 2378 |
| 96 | Ga0451577_0000017 | 3300042876 | Bacteria | 523453 |
| 97 | Ga0451577_0300933 | 3300042876 | Bacteria | 1453 |
| 98 | Ga0453684_0016047 | 3300044712 | Bacteria | 11758 |
| 99 | Ga0453684_0019783 | 3300044712 | Bacteria | 10217 |
| 100 | Ga0451576_0080351 | 3300045051 | Bacteria | 3392 |
| 101 | Ga0495638_0046024 | 3300046460 | Bacteria | 2742 |
| 102 | Ga0495638_0280552 | 3300046460 | Bacteria | 905 |
| 103 | Ga0495686_0089527 | 3300047472 | Bacteria | 1870 |
| 104 | Ga0496101_0225988 | 3300048904 | Bacteria | 1454 |
| 105 | Ga0496102_0336311 | 3300048905 | Bacteria | 1422 |
| 106 | Ga0496105_0049256 | 3300048908 | Bacteria | 3478 |
| 107 | Ga0496110_0051052 | 3300048913 | Bacteria | 3634 |
| 108 | Ga0496126_0130143 | 3300048929 | Bacteria | 2175 |
| 109 | Ga0501034_0041722 | 3300049571 | Bacteria | 4643 |
| 110 | Ga0501047_0467260 | 3300049581 | Bacteria | 1090 |
| 111 | Ga0501080_0363240 | 3300049742 | Bacteria | 1306 |
| 112 | nmdc:mga0yw44_10800_c1 | 3300050492 | Bacteria | 4679 |
| 113 | Ga0500651_0071406 | 3300053093 | Bacteria | 2160 |
| 114 | Ga0500555_012232 | 3300053103 | Bacteria | 2468 |
| 115 | Ga0500658_0023423 | 3300053134 | Bacteria | 2357 |
| 116 | Ga0500559_0029694 | 3300053136 | Bacteria | 2342 |
| 117 | Ga0500568_0000131 | 3300053139 | Bacteria | 67970 |
| 118 | Ga0500577_0072876 | 3300053142 | Bacteria | 1351 |
| 119 | Ga0500609_001429 | 3300053731 | Bacteria | 3497 |
| 120 | Ga0530510_0036675 | 3300061734 | Bacteria | 3533 |
| 121 | 2509154006 | 2508501128 | Bacteria | 8613869 |
| 122 | 2509371303 | 2509276018 | Bacteria | 6910194 |
| 123 | 2694637968 | 2693429784 | Bacteria | 7241525 |
| 124 | 2756672103 | 2756170246 | Bacteria | 7451806 |
| 125 | 2788433303 | 2786546940 | Bacteria | 6396474 |
| 126 | 2824609727 | 2824609381 | Bacteria | 8672835 |
| 127 | 2824655277 | 2824653114 | Bacteria | 8493680 |
| 128 | 2824671633 | 2824671348 | Bacteria | 8369588 |
| 129 | 2824688241 | 2824687955 | Bacteria | 8360029 |
| 130 | 2824696404 | 2824696289 | Bacteria | 8335049 |
| 131 | 2840883489 | 2840878972 | Bacteria | 5483153 |
| 132 | 2841738726 | 2841734538 | Bacteria | 6784580 |
| 133 | 2869256405 | 2869249662 | Bacteria | 6868783 |
| 134 | 2869266787 | 2869264136 | Bacteria | 6880765 |
| 135 | 2871454113 | 2871451962 | Bacteria | 7336357 |
| 136 | 2871460806 | 2871459585 | Bacteria | 6866887 |
| 137 | 2871467279 | 2871466892 | Bacteria | 6923287 |
| 138 | 2871475247 | 2871474448 | Bacteria | 6806570 |
| 139 | 2874136960 | 2874131515 | Bacteria | 6820270 |
| 140 | 2876379150 | 2876377896 | Bacteria | 6565995 |
| 141 | 2879090461 | 2879083081 | Bacteria | 8587928 |
| 142 | 2903732517 | 2903727486 | Bacteria | 8281579 |
| 143 | 2906368645 | 2906363423 | Bacteria | 6856682 |
| 144 | 2906380774 | 2906378014 | Bacteria | 6911440 |
| 145 | 2906606925 | 2906602504 | Bacteria | 8295279 |
| 146 | 2935781738 | 2935777560 | Bacteria | 8077691 |
| 147 | 2935981782 | 2935975950 | Bacteria | 8347125 |
| 148 | 2937842006 | 2937836603 | Bacteria | 6811263 |
| 149 | 2937847887 | 2937843397 | Bacteria | 5256375 |
| 150 | 2937871369 | 2937868953 | Bacteria | 6639878 |
| 151 | 2958071670 | 2958071322 | Bacteria | 6815895 |
| 152 | 2965046238 | 2965040258 | Bacteria | 6855979 |
| 153 | 2965092984 | 2965089291 | Bacteria | 6866420 |
| 154 | 2977916522 | 2977915119 | Bacteria | 6829656 |
| 155 | 2977957123 | 2977950692 | Bacteria | 6893264 |
| 156 | 3004168328 | 3004167301 | Bacteria | 8330599 |
| 157 | 3004203406 | 3004195979 | Bacteria | 6776956 |
| 158 | 3005603259 | 3005594810 | Bacteria | 8716512 |
| 159 | 3005725731 | 3005718088 | Bacteria | 8283608 |
| 160 | 8004364844 | 8004361976 | Bacteria | 6858373 |
| 161 | 8004639736 | 8004633249 | Bacteria | 6723080 |
| 162 | 8004696006 | 8004695233 | Bacteria | 6731676 |
| 163 | 8019621031 | 8019619141 | Bacteria | 9218857 |
| 164 | 8019629539 | 8019629233 | Bacteria | 8687553 |
| 165 | 8019648738 | 8019638758 | Bacteria | 9062356 |
| 166 | 8019659821 | 8019659431 | Bacteria | 8577854 |
| 167 | 8019669127 | 8019668869 | Bacteria | 8791617 |
| 168 | 8056971750 | 8056967851 | Bacteria | 9038162 |
| 169 | Ga0436365_1776081 | |||
| 170 | JGI25153J46596_10000035 | |||
| 171 | rootH2_10026431 | |||
| 172 | rootH2_10078987 | |||
| 173 | Ga0070683_100026886 | |||
| 174 | Ga0070660_100423046 | |||
| 175 | Ga0070668_100059040 | |||
| 176 | Ga0070668_100228540 | |||
| 177 | Ga0070667_100022717 | |||
| 178 | Ga0070667_100054259 | |||
| 179 | Ga0070713_100262043 | |||
| 180 | Ga0070708_100069823 | |||
| 181 | Ga0070706_100034159 | |||
| 182 | Ga0070707_100053743 | |||
| 183 | Ga0070698_100000225 | |||
| 184 | Ga0070699_100026281 | |||
| 185 | Ga0070697_100026509 | |||
| 186 | Ga0070665_100000065 | |||
| 187 | Ga0070665_100048213 | |||
| 188 | Ga0070665_100071035 | |||
| 189 | Ga0070665_100137344 | |||
| 190 | Ga0068859_100000547 | |||
| 191 | Ga0068851_10043944 | |||
| 192 | Ga0068862_100000290 | |||
| 193 | Ga0070717_10000003 | |||
| 194 | Ga0070717_10003966 | |||
| 195 | Ga0075365_10038368 | |||
| 196 | Ga0097620_100000547 | |||
| 197 | Ga0105240_10119541 | |||
| 198 | Ga0105240_10285615 | |||
| 199 | Ga0105240_10288016 | |||
| 200 | Ga0105248_10335822 | |||
| 201 | Ga0105239_10086693 | |||
| 202 | Ga0163163_10058762 | |||
| 203 | Ga0213876_10005216 | |||
| 204 | Ga0209758_1000028 | |||
| 205 | Ga0207656_10076445 | |||
| 206 | Ga0207684_10037441 | |||
| 207 | Ga0207695_10053757 | |||
| 208 | Ga0207671_10061414 | |||
| 209 | Ga0207646_10092106 | |||
| 210 | Ga0207644_10012896 | |||
| 211 | Ga0207661_10017415 | |||
| 212 | Ga0207678_10395754 | |||
| 213 | Ga0268266_10000001 | |||
| 214 | Ga0268265_10000136 | |||
| 215 | Ga0268264_10184109 | |||
| 216 | Ga0265319_1000040 | |||
| 217 | Ga0265319_1000264 | |||
| 218 | Ga0265319_1003672 | |||
| 219 | Ga0265319_1007457 | |||
| 220 | Ga0265319_1024633 | |||
| 221 | Ga0265334_10004923 | |||
| 222 | Ga0265318_10000034 | |||
| 223 | Ga0265318_10000088 | |||
| 224 | Ga0265318_10000301 | |||
| 225 | Ga0265318_10038046 | |||
| 226 | Ga0265318_10050402 | |||
| 227 | Ga0265338_10001729 | |||
| 228 | Ga0265338_10061944 | |||
| 229 | Ga0265324_10043604 | |||
| 230 | Ga0265320_10000451 | |||
| 231 | Ga0265320_10001523 | |||
| 232 | Ga0265320_10018775 | |||
| 233 | Ga0265320_10025104 | |||
| 234 | Ga0265320_10043571 | |||
| 235 | Ga0265339_10037368 | |||
| 236 | Ga0265331_10009345 | |||
| 237 | Ga0265331_10039117 | |||
| 238 | Ga0265327_10000281 | |||
| 239 | Ga0265327_10000631 | |||
| 240 | Ga0265327_10018195 | |||
| 241 | Ga0265316_10007918 | |||
| 242 | Ga0265316_10115477 | |||
| 243 | Ga0265316_10162267 | |||
| 244 | Ga0307513_10068360 | |||
| 245 | Ga0265313_10001077 | |||
| 246 | Ga0265313_10001253 | |||
| 247 | Ga0265313_10003769 | |||
| 248 | Ga0265313_10025603 | |||
| 249 | Ga0307508_10000044 | |||
| 250 | Ga0265314_10001495 | |||
| 251 | Ga0265314_10003144 | |||
| 252 | Ga0265314_10004607 | |||
| 253 | Ga0265314_10113776 | |||
| 254 | Ga0265342_10010309 | |||
| 255 | Ga0265342_10080280 | |||
| 256 | Ga0316578_10031194 | |||
| 257 | Ga0307516_10056913 | |||
| 258 | Ga0316580_10043435 | |||
| 259 | Ga0373931_0079946 | |||
| 260 | Ga0395905_0060441 | |||
| 261 | Ga0395905_0098162 | |||
| 262 | Ga0436365_0729669 | |||
| 263 | Ga0439445_0008716 | |||
| 264 | Ga0451577_0000017 | |||
| 265 | Ga0451577_0300933 | |||
| 266 | Ga0453684_0016047 | |||
| 267 | Ga0453684_0019783 | |||
| 268 | Ga0451576_0080351 | |||
| 269 | Ga0495638_0046024 | |||
| 270 | Ga0495638_0280552 | |||
| 271 | Ga0495686_0089527 | |||
| 272 | Ga0496101_0225988 | |||
| 273 | Ga0496102_0336311 | |||
| 274 | Ga0496105_0049256 | |||
| 275 | Ga0496110_0051052 | |||
| 276 | Ga0496126_0130143 | |||
| 277 | Ga0501034_0041722 | |||
| 278 | Ga0501047_0467260 | |||
| 279 | Ga0501080_0363240 | |||
| 280 | nmdc:mga0yw44_10800_c1 | |||
| 281 | Ga0500651_0071406 | |||
| 282 | Ga0500555_012232 | |||
| 283 | Ga0500658_0023423 | |||
| 284 | Ga0500559_0029694 | |||
| 285 | Ga0500568_0000131 | |||
| 286 | Ga0500577_0072876 | |||
| 287 | Ga0500609_001429 | |||
| 288 | Ga0530510_0036675 | |||
| 289 | 2509154006 | |||
| 290 | 2509371303 | |||
| 291 | 2694637968 | |||
| 292 | 2756672103 | |||
| 293 | 2788433303 | |||
| 294 | 2824609727 | |||
| 295 | 2824655277 | |||
| 296 | 2824671633 | |||
| 297 | 2824688241 | |||
| 298 | 2824696404 | |||
| 299 | 2840883489 | |||
| 300 | 2841738726 | |||
| 301 | 2869256405 | |||
| 302 | 2869266787 | |||
| 303 | 2871454113 | |||
| 304 | 2871460806 | |||
| 305 | 2871467279 | |||
| 306 | 2871475247 | |||
| 307 | 2874136960 | |||
| 308 | 2876379150 | |||
| 309 | 2879090461 | |||
| 310 | 2903732517 | |||
| 311 | 2906368645 | |||
| 312 | 2906380774 | |||
| 313 | 2906606925 | |||
| 314 | 2935781738 | |||
| 315 | 2935981782 | |||
| 316 | 2937842006 | |||
| 317 | 2937847887 | |||
| 318 | 2937871369 | |||
| 319 | 2958071670 | |||
| 320 | 2965046238 | |||
| 321 | 2965092984 | |||
| 322 | 2977916522 | |||
| 323 | 2977957123 | |||
| 324 | 3004168328 | |||
| 325 | 3004203406 | |||
| 326 | 3005603259 | |||
| 327 | 3005725731 | |||
| 328 | 8004364844 | |||
| 329 | 8004639736 | |||
| 330 | 8004696006 | |||
| 331 | 8019621031 | |||
| 332 | 8019629539 | |||
| 333 | 8019648738 | |||
| 334 | 8019659821 | |||
| 335 | 8019669127 | |||
| 336 | 8056971750 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1rk2-assembly2.cif.gz_C | e. coli ribokinase complexed with ribose and adp, solved in space group p212121 | 0.953 | 4 | 305 |
| 4xda-assembly1.cif.gz_A | vibrio cholerae o395 ribokinase complexed with ribose, adp and sodium ion. | 0.9484 | 4 | 305 |
| 1rk2-assembly2.cif.gz_C | e. coli ribokinase complexed with ribose and adp, solved in space group p212121 | 0.938 | 4 | 305 |
| 6znx-assembly1.cif.gz_A | ribokinase from thermus species | 0.9373 | 6 | 305 |
| 8cqx-assembly1.cif.gz_A | ribokinase from t.sp mutant a92g | 0.9351 | 6 | 304 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3go6A00 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.9139 | 4 | 305 | 3.40.1190.20 |
| af_Q9VK96_1_314_3.40.1190.20 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.9101 | 6 | 304 | 3.40.1190.20 |
| af_O60116_1_317_3.40.1190.20 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.9031 | 4 | 302 | 3.40.1190.20 |
| af_Q19133_1_311_3.40.1190.20 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.9027 | 3 | 298 | 3.40.1190.20 |
| af_Q9H477_1_322_3.40.1190.20 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.9017 | 2 | 298 | 3.40.1190.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A800K789-F1-model_v4 | Ribokinase (EC 2.7.1.15) | 0.9761 | 204 | 298 |
GO:0004747
GO:0005829 |
| AF-X1MXL0-F1-model_v4 | Carbohydrate kinase PfkB domain-containing protein | 0.967 | 215 | 305 |
GO:0006796
GO:0016301 |
| AF-A0A836RLE0-F1-model_v4 | Carbohydrate kinase PfkB domain-containing protein | 0.9588 | 206 | 305 |
GO:0005829
GO:0006796 GO:0016301 |
| AF-A0A3N6ATH6-F1-model_v4 | deleted | 0.9517 | 37 | 305 |
|
| AF-A0A7V4H0H2-F1-model_v4 | Ribokinase | 0.9489 | 63 | 305 |
GO:0004747
GO:0005524 GO:0005829 GO:0006014 GO:0046872 |