F253105

General Info

Members Datasets Scaffolds Average Seq Length
168 129 336 317

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1776081|Ga0436365_1776081_5094_6269
Length 391
Sequence MRTKDRVAIGGNDMAAGKKRDGPRVVRRIFTLGLTLGEHAVCARIVEISFFPFATARYAAEKMMPSPAPEKNRVLVIGSFVQDLTWDCAEFPRAGETVIGRFRTGPGGKGSNQAVAAARAGARVTFVGGLGKDTFGDGAREFLRAEGIDCRAVEKSGVATGTAGILVNAHGQNEIVVALGASAALQPADLDAQMDIFKSAAVVLVQHEATLEVNAHALRRARAAGALTMLNPAPMRADFDPAILSSVDLLVPNETEFAALVNRLPDAAAKIGGEPFNETALAALDTAALQALCRCCGVPTVIITLGARGCFVSTSAGGELVPAVTDVRVVDTTGAGDAFAGALAAGLAEFGRGEVARAARFANVAAALSVTRVGTAPAMPRRAEIDALFSA

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
24 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
25 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
26 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
27 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
28 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
40 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
41 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
42 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
43 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
44 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
45 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
46 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
47 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
48 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
49 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
50 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
51 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
52 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
53 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
54 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
55 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
56 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
57 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
58 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
59 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
60 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
61 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
62 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
63 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
64 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
65 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
66 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
67 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
68 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
69 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
70 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
73 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
74 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
75 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
76 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
77 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
78 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
79 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
80 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
81 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
82 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
83 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
84 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
85 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
86 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
87 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
88 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
89 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
90 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
91 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
92 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
93 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
94 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
95 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
96 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
97 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
98 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
99 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
100 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
101 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
102 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
103 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
104 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
105 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
106 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
107 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
108 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
109 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
110 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
111 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
112 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
113 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
114 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
115 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
116 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
117 3004167301 Mesorhizobium loti 582 Isolate Unclassified
118 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
119 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
120 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
121 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
122 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
123 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
124 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
125 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
126 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
127 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
128 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
129 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 71.43
Metatranscriptomes 0
Isolates 28.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.55
Nodule 20.83
Rhizoplane 2.38
Rhizosphere 58.93
Stem 0
Stem Tuber 0
Unclassified 2.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_1776081 3300039437 Bacteria 15207
2 JGI25153J46596_10000035 3300003215 Bacteria 189737
3 rootH2_10026431 3300003320 Bacteria 10117
4 rootH2_10078987 3300003320 Bacteria 1868
5 Ga0070683_100026886 3300005329 Bacteria 5187
6 Ga0070660_100423046 3300005339 Bacteria 1103
7 Ga0070668_100059040 3300005347 Bacteria 2969
8 Ga0070668_100228540 3300005347 Bacteria 1537
9 Ga0070667_100022717 3300005367 Bacteria 5201
10 Ga0070667_100054259 3300005367 Bacteria 3384
11 Ga0070713_100262043 3300005436 Bacteria 1580
12 Ga0070708_100069823 3300005445 Unclassified 3159
13 Ga0070706_100034159 3300005467 Bacteria 4696
14 Ga0070707_100053743 3300005468 Bacteria 3862
15 Ga0070698_100000225 3300005471 Bacteria 55661
16 Ga0070699_100026281 3300005518 Bacteria 5021
17 Ga0070697_100026509 3300005536 Bacteria 4631
18 Ga0070665_100000065 3300005548 Bacteria 212975
19 Ga0070665_100048213 3300005548 Bacteria 4277
20 Ga0070665_100071035 3300005548 Bacteria 3488
21 Ga0070665_100137344 3300005548 Bacteria 2448
22 Ga0068859_100000547 3300005617 Bacteria 37255
23 Ga0068851_10043944 3300005834 Bacteria 2253
24 Ga0068862_100000290 3300005844 Bacteria 55379
25 Ga0070717_10000003 3300006028 Bacteria 370103
26 Ga0070717_10003966 3300006028 Bacteria 10651
27 Ga0075365_10038368 3300006038 Bacteria 3113
28 Ga0097620_100000547 3300006931 Bacteria 37255
29 Ga0105240_10119541 3300009093 Bacteria 3174
30 Ga0105240_10285615 3300009093 Bacteria 1894
31 Ga0105240_10288016 3300009093 Bacteria 1884
32 Ga0105248_10335822 3300009177 Bacteria 1702
33 Ga0105239_10086693 3300010375 Bacteria 3451
34 Ga0163163_10058762 3300014325 Bacteria 3803
35 Ga0213876_10005216 3300021384 Bacteria 7161
36 Ga0209758_1000028 3300025297 Bacteria 530102
37 Ga0207656_10076445 3300025321 Bacteria 1498
38 Ga0207684_10037441 3300025910 Bacteria 4116
39 Ga0207695_10053757 3300025913 Bacteria 4209
40 Ga0207671_10061414 3300025914 Bacteria 2788
41 Ga0207646_10092106 3300025922 Bacteria 2713
42 Ga0207644_10012896 3300025931 Bacteria 5556
43 Ga0207661_10017415 3300025944 Bacteria 5317
44 Ga0207678_10395754 3300026067 Bacteria 1196
45 Ga0268266_10000001 3300028379 Bacteria 4040580
46 Ga0268265_10000136 3300028380 Bacteria 93413
47 Ga0268264_10184109 3300028381 Bacteria 1899
48 Ga0265319_1000040 3300028563 Bacteria 112246
49 Ga0265319_1000264 3300028563 Bacteria 39616
50 Ga0265319_1003672 3300028563 Bacteria 7915
51 Ga0265319_1007457 3300028563 Bacteria 4918
52 Ga0265319_1024633 3300028563 Bacteria 2163
53 Ga0265334_10004923 3300028573 Bacteria 5870
54 Ga0265318_10000034 3300028577 Bacteria 143153
55 Ga0265318_10000088 3300028577 Bacteria 82498
56 Ga0265318_10000301 3300028577 Bacteria 40135
57 Ga0265318_10038046 3300028577 Bacteria 1841
58 Ga0265318_10050402 3300028577 Bacteria 1564
59 Ga0265338_10001729 3300028800 Bacteria 34551
60 Ga0265338_10061944 3300028800 Unclassified 3275
61 Ga0265324_10043604 3300029957 Bacteria 1547
62 Ga0265320_10000451 3300031240 Bacteria 32255
63 Ga0265320_10001523 3300031240 Bacteria 16816
64 Ga0265320_10018775 3300031240 Bacteria 3798
65 Ga0265320_10025104 3300031240 Unclassified 3139
66 Ga0265320_10043571 3300031240 Unclassified 2217
67 Ga0265339_10037368 3300031249 Bacteria 2714
68 Ga0265331_10009345 3300031250 Bacteria 5508
69 Ga0265331_10039117 3300031250 Bacteria 2314
70 Ga0265327_10000281 3300031251 Bacteria 100389
71 Ga0265327_10000631 3300031251 Bacteria 57438
72 Ga0265327_10018195 3300031251 Bacteria 4366
73 Ga0265316_10007918 3300031344 Bacteria 9941
74 Ga0265316_10115477 3300031344 Unclassified 2030
75 Ga0265316_10162267 3300031344 Bacteria 1670
76 Ga0307513_10068360 3300031456 Bacteria 3722
77 Ga0265313_10001077 3300031595 Bacteria 26378
78 Ga0265313_10001253 3300031595 Bacteria 24176
79 Ga0265313_10003769 3300031595 Bacteria 12027
80 Ga0265313_10025603 3300031595 Bacteria 3121
81 Ga0307508_10000044 3300031616 Bacteria 143750
82 Ga0265314_10001495 3300031711 Bacteria 25964
83 Ga0265314_10003144 3300031711 Bacteria 16196
84 Ga0265314_10004607 3300031711 Bacteria 12717
85 Ga0265314_10113776 3300031711 Bacteria 1715
86 Ga0265342_10010309 3300031712 Bacteria 6498
87 Ga0265342_10080280 3300031712 Bacteria 1885
88 Ga0316578_10031194 3300031728 Bacteria 3035
89 Ga0307516_10056913 3300031730 Bacteria 3811
90 Ga0316580_10043435 3300032139 Bacteria 1387
91 Ga0373931_0079946 3300035691 Bacteria 1802
92 Ga0395905_0060441 3300037471 Bacteria 3543
93 Ga0395905_0098162 3300037471 Bacteria 2751
94 Ga0436365_0729669 3300039437 Bacteria 5459
95 Ga0439445_0008716 3300042004 Bacteria 2378
96 Ga0451577_0000017 3300042876 Bacteria 523453
97 Ga0451577_0300933 3300042876 Bacteria 1453
98 Ga0453684_0016047 3300044712 Bacteria 11758
99 Ga0453684_0019783 3300044712 Bacteria 10217
100 Ga0451576_0080351 3300045051 Bacteria 3392
101 Ga0495638_0046024 3300046460 Bacteria 2742
102 Ga0495638_0280552 3300046460 Bacteria 905
103 Ga0495686_0089527 3300047472 Bacteria 1870
104 Ga0496101_0225988 3300048904 Bacteria 1454
105 Ga0496102_0336311 3300048905 Bacteria 1422
106 Ga0496105_0049256 3300048908 Bacteria 3478
107 Ga0496110_0051052 3300048913 Bacteria 3634
108 Ga0496126_0130143 3300048929 Bacteria 2175
109 Ga0501034_0041722 3300049571 Bacteria 4643
110 Ga0501047_0467260 3300049581 Bacteria 1090
111 Ga0501080_0363240 3300049742 Bacteria 1306
112 nmdc:mga0yw44_10800_c1 3300050492 Bacteria 4679
113 Ga0500651_0071406 3300053093 Bacteria 2160
114 Ga0500555_012232 3300053103 Bacteria 2468
115 Ga0500658_0023423 3300053134 Bacteria 2357
116 Ga0500559_0029694 3300053136 Bacteria 2342
117 Ga0500568_0000131 3300053139 Bacteria 67970
118 Ga0500577_0072876 3300053142 Bacteria 1351
119 Ga0500609_001429 3300053731 Bacteria 3497
120 Ga0530510_0036675 3300061734 Bacteria 3533
121 2509154006 2508501128 Bacteria 8613869
122 2509371303 2509276018 Bacteria 6910194
123 2694637968 2693429784 Bacteria 7241525
124 2756672103 2756170246 Bacteria 7451806
125 2788433303 2786546940 Bacteria 6396474
126 2824609727 2824609381 Bacteria 8672835
127 2824655277 2824653114 Bacteria 8493680
128 2824671633 2824671348 Bacteria 8369588
129 2824688241 2824687955 Bacteria 8360029
130 2824696404 2824696289 Bacteria 8335049
131 2840883489 2840878972 Bacteria 5483153
132 2841738726 2841734538 Bacteria 6784580
133 2869256405 2869249662 Bacteria 6868783
134 2869266787 2869264136 Bacteria 6880765
135 2871454113 2871451962 Bacteria 7336357
136 2871460806 2871459585 Bacteria 6866887
137 2871467279 2871466892 Bacteria 6923287
138 2871475247 2871474448 Bacteria 6806570
139 2874136960 2874131515 Bacteria 6820270
140 2876379150 2876377896 Bacteria 6565995
141 2879090461 2879083081 Bacteria 8587928
142 2903732517 2903727486 Bacteria 8281579
143 2906368645 2906363423 Bacteria 6856682
144 2906380774 2906378014 Bacteria 6911440
145 2906606925 2906602504 Bacteria 8295279
146 2935781738 2935777560 Bacteria 8077691
147 2935981782 2935975950 Bacteria 8347125
148 2937842006 2937836603 Bacteria 6811263
149 2937847887 2937843397 Bacteria 5256375
150 2937871369 2937868953 Bacteria 6639878
151 2958071670 2958071322 Bacteria 6815895
152 2965046238 2965040258 Bacteria 6855979
153 2965092984 2965089291 Bacteria 6866420
154 2977916522 2977915119 Bacteria 6829656
155 2977957123 2977950692 Bacteria 6893264
156 3004168328 3004167301 Bacteria 8330599
157 3004203406 3004195979 Bacteria 6776956
158 3005603259 3005594810 Bacteria 8716512
159 3005725731 3005718088 Bacteria 8283608
160 8004364844 8004361976 Bacteria 6858373
161 8004639736 8004633249 Bacteria 6723080
162 8004696006 8004695233 Bacteria 6731676
163 8019621031 8019619141 Bacteria 9218857
164 8019629539 8019629233 Bacteria 8687553
165 8019648738 8019638758 Bacteria 9062356
166 8019659821 8019659431 Bacteria 8577854
167 8019669127 8019668869 Bacteria 8791617
168 8056971750 8056967851 Bacteria 9038162
169 Ga0436365_1776081
170 JGI25153J46596_10000035
171 rootH2_10026431
172 rootH2_10078987
173 Ga0070683_100026886
174 Ga0070660_100423046
175 Ga0070668_100059040
176 Ga0070668_100228540
177 Ga0070667_100022717
178 Ga0070667_100054259
179 Ga0070713_100262043
180 Ga0070708_100069823
181 Ga0070706_100034159
182 Ga0070707_100053743
183 Ga0070698_100000225
184 Ga0070699_100026281
185 Ga0070697_100026509
186 Ga0070665_100000065
187 Ga0070665_100048213
188 Ga0070665_100071035
189 Ga0070665_100137344
190 Ga0068859_100000547
191 Ga0068851_10043944
192 Ga0068862_100000290
193 Ga0070717_10000003
194 Ga0070717_10003966
195 Ga0075365_10038368
196 Ga0097620_100000547
197 Ga0105240_10119541
198 Ga0105240_10285615
199 Ga0105240_10288016
200 Ga0105248_10335822
201 Ga0105239_10086693
202 Ga0163163_10058762
203 Ga0213876_10005216
204 Ga0209758_1000028
205 Ga0207656_10076445
206 Ga0207684_10037441
207 Ga0207695_10053757
208 Ga0207671_10061414
209 Ga0207646_10092106
210 Ga0207644_10012896
211 Ga0207661_10017415
212 Ga0207678_10395754
213 Ga0268266_10000001
214 Ga0268265_10000136
215 Ga0268264_10184109
216 Ga0265319_1000040
217 Ga0265319_1000264
218 Ga0265319_1003672
219 Ga0265319_1007457
220 Ga0265319_1024633
221 Ga0265334_10004923
222 Ga0265318_10000034
223 Ga0265318_10000088
224 Ga0265318_10000301
225 Ga0265318_10038046
226 Ga0265318_10050402
227 Ga0265338_10001729
228 Ga0265338_10061944
229 Ga0265324_10043604
230 Ga0265320_10000451
231 Ga0265320_10001523
232 Ga0265320_10018775
233 Ga0265320_10025104
234 Ga0265320_10043571
235 Ga0265339_10037368
236 Ga0265331_10009345
237 Ga0265331_10039117
238 Ga0265327_10000281
239 Ga0265327_10000631
240 Ga0265327_10018195
241 Ga0265316_10007918
242 Ga0265316_10115477
243 Ga0265316_10162267
244 Ga0307513_10068360
245 Ga0265313_10001077
246 Ga0265313_10001253
247 Ga0265313_10003769
248 Ga0265313_10025603
249 Ga0307508_10000044
250 Ga0265314_10001495
251 Ga0265314_10003144
252 Ga0265314_10004607
253 Ga0265314_10113776
254 Ga0265342_10010309
255 Ga0265342_10080280
256 Ga0316578_10031194
257 Ga0307516_10056913
258 Ga0316580_10043435
259 Ga0373931_0079946
260 Ga0395905_0060441
261 Ga0395905_0098162
262 Ga0436365_0729669
263 Ga0439445_0008716
264 Ga0451577_0000017
265 Ga0451577_0300933
266 Ga0453684_0016047
267 Ga0453684_0019783
268 Ga0451576_0080351
269 Ga0495638_0046024
270 Ga0495638_0280552
271 Ga0495686_0089527
272 Ga0496101_0225988
273 Ga0496102_0336311
274 Ga0496105_0049256
275 Ga0496110_0051052
276 Ga0496126_0130143
277 Ga0501034_0041722
278 Ga0501047_0467260
279 Ga0501080_0363240
280 nmdc:mga0yw44_10800_c1
281 Ga0500651_0071406
282 Ga0500555_012232
283 Ga0500658_0023423
284 Ga0500559_0029694
285 Ga0500568_0000131
286 Ga0500577_0072876
287 Ga0500609_001429
288 Ga0530510_0036675
289 2509154006
290 2509371303
291 2694637968
292 2756672103
293 2788433303
294 2824609727
295 2824655277
296 2824671633
297 2824688241
298 2824696404
299 2840883489
300 2841738726
301 2869256405
302 2869266787
303 2871454113
304 2871460806
305 2871467279
306 2871475247
307 2874136960
308 2876379150
309 2879090461
310 2903732517
311 2906368645
312 2906380774
313 2906606925
314 2935781738
315 2935981782
316 2937842006
317 2937847887
318 2937871369
319 2958071670
320 2965046238
321 2965092984
322 2977916522
323 2977957123
324 3004168328
325 3004203406
326 3005603259
327 3005725731
328 8004364844
329 8004639736
330 8004696006
331 8019621031
332 8019629539
333 8019648738
334 8019659821
335 8019669127
336 8056971750

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00294

PfkB

pfkB family carbohydrate kinase

71

382

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rk2-assembly2.cif.gz_C e. coli ribokinase complexed with ribose and adp, solved in space group p212121 0.953 4 305
4xda-assembly1.cif.gz_A vibrio cholerae o395 ribokinase complexed with ribose, adp and sodium ion. 0.9484 4 305
1rk2-assembly2.cif.gz_C e. coli ribokinase complexed with ribose and adp, solved in space group p212121 0.938 4 305
6znx-assembly1.cif.gz_A ribokinase from thermus species 0.9373 6 305
8cqx-assembly1.cif.gz_A ribokinase from t.sp mutant a92g 0.9351 6 304
ID Description Score Start End Superfamily
3go6A00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9139 4 305 3.40.1190.20
af_Q9VK96_1_314_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9101 6 304 3.40.1190.20
af_O60116_1_317_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9031 4 302 3.40.1190.20
af_Q19133_1_311_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9027 3 298 3.40.1190.20
af_Q9H477_1_322_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9017 2 298 3.40.1190.20
ID Description Score Start End GO Terms
AF-A0A800K789-F1-model_v4 Ribokinase (EC 2.7.1.15) 0.9761 204 298 GO:0004747
GO:0005829
AF-X1MXL0-F1-model_v4 Carbohydrate kinase PfkB domain-containing protein 0.967 215 305 GO:0006796
GO:0016301
AF-A0A836RLE0-F1-model_v4 Carbohydrate kinase PfkB domain-containing protein 0.9588 206 305 GO:0005829
GO:0006796
GO:0016301
AF-A0A3N6ATH6-F1-model_v4 deleted 0.9517 37 305
AF-A0A7V4H0H2-F1-model_v4 Ribokinase 0.9489 63 305 GO:0004747
GO:0005524
GO:0005829
GO:0006014
GO:0046872

Map