F252831

General Info

Members Datasets Scaffolds Average Seq Length
168 120 336 132

Family's Representative Sequence

Representative Sequence 3300025937|Ga0207669_11149289|Ga0207669_111492892
Length 162
Sequence MMKSPPPLAPSRTCIWPRLSCGAVVTGWCRGHGRAAGPRSFPPTAPYTVTEVAVRAFAEATGGEYAGGPAPATFPIVLAFDAMNAFLEAERLDLFRIVHGEQRFAYERPVVPGDVLTATLSVASLRQIGGNDIIGTTSEITDSTGSLVCSTSATLVHRGPDQ

Samples

Sample ID Description Type Environment
1 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
17 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
34 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
35 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
38 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
39 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
40 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
59 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
61 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
62 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
63 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
64 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
65 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
66 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
67 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
68 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
69 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
70 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
71 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
72 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
73 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
74 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
75 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
76 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
77 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
78 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
79 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
80 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
81 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
82 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
90 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
91 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
92 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
93 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
94 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
95 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
96 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
97 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
98 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
99 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
100 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
102 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
103 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
104 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
105 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
106 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
107 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
108 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
109 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
110 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
111 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
112 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
113 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
114 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
115 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
116 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
117 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
118 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
119 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
120 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 95.83
Metatranscriptomes 0.6
Isolates 3.57

Biome Distribution

Category Percentage (%)
Aerial Root 1.19
Bulb 0
Endosphere 23.21
Nodule 0
Rhizoplane 4.76
Rhizosphere 65.48
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207669_11149289 3300025937 Bacteria 657
2 Ga0070658_10399768 3300005327 Bacteria 1180
3 Ga0070683_100308052 3300005329 Bacteria 1507
4 Ga0070670_102202833 3300005331 Bacteria 508
5 Ga0068869_100575050 3300005334 Bacteria 949
6 Ga0068868_100627075 3300005338 Bacteria 955
7 Ga0070668_100135734 3300005347 Bacteria 1979
8 Ga0070671_100378445 3300005355 Bacteria 1210
9 Ga0070674_100634271 3300005356 Bacteria 907
10 Ga0070688_101076970 3300005365 Bacteria 642
11 Ga0070667_100036687 3300005367 Bacteria 4110
12 Ga0070667_100123312 3300005367 Bacteria 2256
13 Ga0070663_100146259 3300005455 Bacteria 1808
14 Ga0068853_101452773 3300005539 Bacteria 664
15 Ga0070672_100059143 3300005543 Bacteria 3015
16 Ga0070664_100279737 3300005564 Bacteria 1505
17 Ga0070702_100204518 3300005615 Bacteria 1309
18 Ga0068866_11055421 3300005718 Bacteria 580
19 Ga0068861_100033179 3300005719 Bacteria 3806
20 Ga0068870_10291489 3300005840 Bacteria 1027
21 Ga0068860_100003554 3300005843 Bacteria 16028
22 Ga0068862_101075167 3300005844 Bacteria 799
23 Ga0081539_10025116 3300005985 Bacteria 3846
24 Ga0075365_10000602 3300006038 Bacteria 14118
25 Ga0075365_10064611 3300006038 Bacteria 2452
26 Ga0075365_10564075 3300006038 Bacteria 805
27 Ga0075363_100148262 3300006048 Bacteria 1323
28 Ga0075364_10105621 3300006051 Bacteria 1876
29 Ga0075364_10401208 3300006051 Bacteria 936
30 Ga0075362_10295083 3300006177 Bacteria 804
31 Ga0075370_10013133 3300006353 Bacteria 4395
32 Ga0075370_10821613 3300006353 Bacteria 567
33 Ga0111539_10250629 3300009094 Bacteria 2062
34 Ga0105245_11745186 3300009098 Bacteria 675
35 Ga0105243_10304936 3300009148 Bacteria 1445
36 Ga0105243_10786002 3300009148 Bacteria 937
37 Ga0105248_11653753 3300009177 Bacteria 726
38 Ga0105249_10691115 3300009553 Bacteria 1080
39 Ga0105249_11342809 3300009553 Bacteria 787
40 Ga0105246_10892031 3300011119 Bacteria 797
41 Ga0157378_11575292 3300013297 Bacteria 702
42 Ga0157375_10537717 3300013308 Bacteria 1331
43 Ga0157375_10592656 3300013308 Bacteria 1268
44 Ga0157375_10622993 3300013308 Bacteria 1237
45 Ga0157375_12621541 3300013308 Bacteria 602
46 Ga0163163_10208589 3300014325 Bacteria 2002
47 Ga0163163_10273307 3300014325 Bacteria 1741
48 Ga0157380_10066547 3300014326 Bacteria 2898
49 Ga0157380_10518011 3300014326 Bacteria 1162
50 Ga0157380_13443759 3300014326 Bacteria 506
51 Ga0157377_10155113 3300014745 Bacteria 1419
52 Ga0163161_10100043 3300017792 Bacteria 2157
53 Ga0163161_11242654 3300017792 Bacteria 646
54 Ga0206354_10938351 3300020081 Bacteria 960
55 Ga0207657_10698066 3300025919 Bacteria 788
56 Ga0207644_10321144 3300025931 Bacteria 1252
57 Ga0207690_10471840 3300025932 Bacteria 1011
58 Ga0207709_11374371 3300025935 Bacteria 584
59 Ga0207704_10379972 3300025938 Bacteria 1109
60 Ga0207691_10026248 3300025940 Bacteria 5467
61 Ga0207661_10773682 3300025944 Bacteria 884
62 Ga0207668_10203538 3300025972 Bacteria 1578
63 Ga0207658_10042678 3300025986 Bacteria 3292
64 Ga0207658_10622571 3300025986 Bacteria 971
65 Ga0207639_10448154 3300026041 Bacteria 1171
66 Ga0207678_10082826 3300026067 Bacteria 2744
67 Ga0207708_10234164 3300026075 Bacteria 1475
68 Ga0207648_10081661 3300026089 Bacteria 2819
69 Ga0207676_10832497 3300026095 Bacteria 902
70 Ga0207674_10826971 3300026116 Bacteria 893
71 Ga0207675_100106031 3300026118 Bacteria 2649
72 Ga0207675_100695912 3300026118 Bacteria 1025
73 Ga0207698_11509254 3300026142 Bacteria 687
74 Ga0209813_10066099 3300027866 Bacteria 1166
75 Ga0268264_10000437 3300028381 Bacteria 57431
76 Ga0314311_1177414 3300030733 Bacteria 999
77 Ga0316181_1083895 3300030744 Bacteria 1514
78 Ga0307413_10239492 3300031824 Bacteria 1339
79 Ga0307413_10245417 3300031824 Bacteria 1325
80 Ga0307407_10075793 3300031903 Bacteria 2018
81 Ga0307412_10886716 3300031911 Bacteria 781
82 Ga0307409_100290633 3300031995 Bacteria 1516
83 Ga0307409_100298227 3300031995 Bacteria 1498
84 Ga0307414_10308931 3300032004 Bacteria 1341
85 Ga0307414_10350607 3300032004 Bacteria 1267
86 Ga0307411_11932256 3300032005 Bacteria 550
87 Ga0373931_0145594 3300035691 Bacteria 1377
88 Ga0451798_1170186 3300041458 Bacteria 555
89 Ga0451802_0089221 3300041460 Bacteria 551
90 Ga0451802_0395015 3300041460 Bacteria 614
91 Ga0451806_202698 3300041462 Bacteria 798
92 Ga0451843_1614396 3300041509 Bacteria 648
93 Ga0451853_2164010 3300041512 Bacteria 1318
94 Ga0451853_3288813 3300041512 Bacteria 603
95 Ga0466963_0713122 3300044694 Bacteria 708
96 Ga0466960_0058209 3300044901 Bacteria 1887
97 Ga0466967_1430484 3300045976 Bacteria 689
98 Ga0496105_0953781 3300048908 Bacteria 644
99 Ga0496111_0429093 3300048914 Bacteria 976
100 Ga0496111_0549405 3300048914 Bacteria 848
101 Ga0496114_0790106 3300048917 Bacteria 828
102 Ga0496118_0621424 3300048921 Bacteria 513
103 Ga0496124_0123970 3300048927 Bacteria 2061
104 Ga0501034_1048839 3300049571 Bacteria 698
105 Ga0501036_0044326 3300049572 Bacteria 3768
106 Ga0501038_0446057 3300049574 Bacteria 996
107 Ga0501039_0013602 3300049575 Bacteria 6224
108 Ga0501040_0611941 3300049576 Bacteria 787
109 Ga0501041_0378747 3300049577 Bacteria 895
110 Ga0501041_0970556 3300049577 Bacteria 546
111 Ga0501042_0172158 3300049578 Bacteria 1562
112 Ga0501042_0648309 3300049578 Bacteria 768
113 Ga0501068_1011763 3300049584 Bacteria 548
114 Ga0501068_1152272 3300049584 Bacteria 513
115 Ga0501068_1167052 3300049584 Bacteria 510
116 Ga0501069_0131097 3300049585 Bacteria 1435
117 Ga0501071_0125174 3300049587 Bacteria 1907
118 Ga0501072_0307625 3300049588 Bacteria 1260
119 Ga0501072_0335799 3300049588 Bacteria 1200
120 Ga0501073_0130657 3300049589 Bacteria 1741
121 Ga0501074_0317246 3300049590 Bacteria 1107
122 Ga0501074_0384477 3300049590 Bacteria 996
123 Ga0501077_0624739 3300049593 Bacteria 692
124 Ga0501202_138123 3300049652 Bacteria 628
125 Ga0501079_0791746 3300049741 Bacteria 746
126 Ga0501080_0596087 3300049742 Bacteria 981
127 Ga0501081_0454939 3300049743 Bacteria 951
128 Ga0501081_0748546 3300049743 Bacteria 734
129 Ga0501044_0825496 3300049823 Bacteria 805
130 Ga0501045_0008942 3300049824 Bacteria 6996
131 Ga0501045_0504150 3300049824 Bacteria 899
132 nmdc:mga03683_23072_c1 3300050489 Bacteria 2419
133 nmdc:mga03683_548783_c1 3300050489 Bacteria 562
134 nmdc:mga03n38_223375_c1 3300050490 Bacteria 984
135 nmdc:mga03n38_56459_c1 3300050490 Bacteria 1772
136 nmdc:mga03n38_929945_c1 3300050490 Bacteria 512
137 nmdc:mga00v17_205533_c1 3300050491 Bacteria 1274
138 nmdc:mga00v17_332017_c1 3300050491 Bacteria 988
139 nmdc:mga00v17_436235_c1 3300050491 Bacteria 851
140 nmdc:mga0yw44_125859_c1 3300050492 Bacteria 1655
141 nmdc:mga0yw44_2193_c1 3300050492 Bacteria 8217
142 nmdc:mga0yw44_333090_c1 3300050492 Bacteria 1020
143 nmdc:mga0yw44_344499_c1 3300050492 Bacteria 1003
144 nmdc:mga0yw44_366783_c1 3300050492 Bacteria 971
145 nmdc:mga0yw44_399083_c1 3300050492 Bacteria 930
146 nmdc:mga0yw44_457717_c1 3300050492 Bacteria 865
147 nmdc:mga0yw44_465252_c1 3300050492 Bacteria 857
148 nmdc:mga0yw44_50551_c1 3300050492 Bacteria 2514
149 nmdc:mga0yw44_506080_c1 3300050492 Bacteria 820
150 nmdc:mga0yw44_61043_c1 3300050492 Bacteria 2311
151 nmdc:mga0yw44_9249_c1 3300050492 Bacteria 4963
152 nmdc:mga06z11_112055_c1 3300050494 Bacteria 1512
153 nmdc:mga04h51_53339_c1 3300050495 Bacteria 1364
154 nmdc:mga07m45_194505_c1 3300050496 Bacteria 1180
155 nmdc:mga07m45_36501_c1 3300050496 Bacteria 2738
156 Ga0500644_0062282 3300053088 Bacteria 1318
157 Ga0500554_042556 3300053102 Bacteria 1400
158 Ga0500554_231486 3300053102 Bacteria 613
159 Ga0500556_0004963 3300053104 Bacteria 3765
160 Ga0500573_0402350 3300053140 Bacteria 648
161 Ga0501084_0153128 3300054114 Bacteria 1944
162 Ga0530510_0264215 3300061734 Bacteria 1284
163 2774394884 2773857762 Bacteria 5971770
164 2809194263 2808606439 Bacteria 5952208
165 2812349015 2811994878 Bacteria 5992952
166 2891973229 2891968417 Bacteria 5821697
167 2984579231 2984576629 Bacteria 4248407
168 2990259876 2990256926 Bacteria 4252839
169 Ga0207669_11149289
170 Ga0070658_10399768
171 Ga0070683_100308052
172 Ga0070670_102202833
173 Ga0068869_100575050
174 Ga0068868_100627075
175 Ga0070668_100135734
176 Ga0070671_100378445
177 Ga0070674_100634271
178 Ga0070688_101076970
179 Ga0070667_100036687
180 Ga0070667_100123312
181 Ga0070663_100146259
182 Ga0068853_101452773
183 Ga0070672_100059143
184 Ga0070664_100279737
185 Ga0070702_100204518
186 Ga0068866_11055421
187 Ga0068861_100033179
188 Ga0068870_10291489
189 Ga0068860_100003554
190 Ga0068862_101075167
191 Ga0081539_10025116
192 Ga0075365_10000602
193 Ga0075365_10064611
194 Ga0075365_10564075
195 Ga0075363_100148262
196 Ga0075364_10105621
197 Ga0075364_10401208
198 Ga0075362_10295083
199 Ga0075370_10013133
200 Ga0075370_10821613
201 Ga0111539_10250629
202 Ga0105245_11745186
203 Ga0105243_10304936
204 Ga0105243_10786002
205 Ga0105248_11653753
206 Ga0105249_10691115
207 Ga0105249_11342809
208 Ga0105246_10892031
209 Ga0157378_11575292
210 Ga0157375_10537717
211 Ga0157375_10592656
212 Ga0157375_10622993
213 Ga0157375_12621541
214 Ga0163163_10208589
215 Ga0163163_10273307
216 Ga0157380_10066547
217 Ga0157380_10518011
218 Ga0157380_13443759
219 Ga0157377_10155113
220 Ga0163161_10100043
221 Ga0163161_11242654
222 Ga0206354_10938351
223 Ga0207657_10698066
224 Ga0207644_10321144
225 Ga0207690_10471840
226 Ga0207709_11374371
227 Ga0207704_10379972
228 Ga0207691_10026248
229 Ga0207661_10773682
230 Ga0207668_10203538
231 Ga0207658_10042678
232 Ga0207658_10622571
233 Ga0207639_10448154
234 Ga0207678_10082826
235 Ga0207708_10234164
236 Ga0207648_10081661
237 Ga0207676_10832497
238 Ga0207674_10826971
239 Ga0207675_100106031
240 Ga0207675_100695912
241 Ga0207698_11509254
242 Ga0209813_10066099
243 Ga0268264_10000437
244 Ga0314311_1177414
245 Ga0316181_1083895
246 Ga0307413_10239492
247 Ga0307413_10245417
248 Ga0307407_10075793
249 Ga0307412_10886716
250 Ga0307409_100290633
251 Ga0307409_100298227
252 Ga0307414_10308931
253 Ga0307414_10350607
254 Ga0307411_11932256
255 Ga0373931_0145594
256 Ga0451798_1170186
257 Ga0451802_0089221
258 Ga0451802_0395015
259 Ga0451806_202698
260 Ga0451843_1614396
261 Ga0451853_2164010
262 Ga0451853_3288813
263 Ga0466963_0713122
264 Ga0466960_0058209
265 Ga0466967_1430484
266 Ga0496105_0953781
267 Ga0496111_0429093
268 Ga0496111_0549405
269 Ga0496114_0790106
270 Ga0496118_0621424
271 Ga0496124_0123970
272 Ga0501034_1048839
273 Ga0501036_0044326
274 Ga0501038_0446057
275 Ga0501039_0013602
276 Ga0501040_0611941
277 Ga0501041_0378747
278 Ga0501041_0970556
279 Ga0501042_0172158
280 Ga0501042_0648309
281 Ga0501068_1011763
282 Ga0501068_1152272
283 Ga0501068_1167052
284 Ga0501069_0131097
285 Ga0501071_0125174
286 Ga0501072_0307625
287 Ga0501072_0335799
288 Ga0501073_0130657
289 Ga0501074_0317246
290 Ga0501074_0384477
291 Ga0501077_0624739
292 Ga0501202_138123
293 Ga0501079_0791746
294 Ga0501080_0596087
295 Ga0501081_0454939
296 Ga0501081_0748546
297 Ga0501044_0825496
298 Ga0501045_0008942
299 Ga0501045_0504150
300 nmdc:mga03683_23072_c1
301 nmdc:mga03683_548783_c1
302 nmdc:mga03n38_223375_c1
303 nmdc:mga03n38_56459_c1
304 nmdc:mga03n38_929945_c1
305 nmdc:mga00v17_205533_c1
306 nmdc:mga00v17_332017_c1
307 nmdc:mga00v17_436235_c1
308 nmdc:mga0yw44_125859_c1
309 nmdc:mga0yw44_2193_c1
310 nmdc:mga0yw44_333090_c1
311 nmdc:mga0yw44_344499_c1
312 nmdc:mga0yw44_366783_c1
313 nmdc:mga0yw44_399083_c1
314 nmdc:mga0yw44_457717_c1
315 nmdc:mga0yw44_465252_c1
316 nmdc:mga0yw44_50551_c1
317 nmdc:mga0yw44_506080_c1
318 nmdc:mga0yw44_61043_c1
319 nmdc:mga0yw44_9249_c1
320 nmdc:mga06z11_112055_c1
321 nmdc:mga04h51_53339_c1
322 nmdc:mga07m45_194505_c1
323 nmdc:mga07m45_36501_c1
324 Ga0500644_0062282
325 Ga0500554_042556
326 Ga0500554_231486
327 Ga0500556_0004963
328 Ga0500573_0402350
329 Ga0501084_0153128
330 Ga0530510_0264215
331 2774394884
332 2809194263
333 2812349015
334 2891973229
335 2984579231
336 2990259876

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22622

MFE-2_hydrat-2_N

MFE-2 hydratase 2 N-terminal domain

69

159

0.93

PF13452

MaoC_dehydrat_N

N-terminal half of MaoC dehydratase

38

151

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rlj-assembly1.cif.gz_A crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis 0.8784 3 128
7svt-assembly4.cif.gz_V mycobacterium tuberculosis 3-hydroxyl-acp dehydratase hadab in complex with 1,3-diarylpyrazolyl-acylsulfonamide inhibitor 0.8745 4 129
4rlu-assembly1.cif.gz_A crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis complexed with 2',4,4'-trihydroxychalcone 0.8714 1 128
5zy8-assembly1.cif.gz_C crystal structure of c terminal truncated hadbc (3r-hydroxyacyl-acp dehydratase) complex from mycobacterium tuberculosis 0.8709 7 125
4rlt-assembly1.cif.gz_A crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis complexed with fisetin 0.8686 1 129
ID Description Score Start End Superfamily
af_Q19058_11_287_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8805 12 129 3.10.129.10
af_Q02207_619_772_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8789 17 128 3.10.129.10
af_P9WFJ9_1_152_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8774 1 130 3.10.129.10
af_A0A1D8PLR8_89_286_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8727 65 131 3.10.129.10
4rltA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8687 1 129 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A6G6W8K9-F1-model_v4 MaoC family dehydratase 0.9911 1 130
AF-A0A1I3HZJ6-F1-model_v4 Acyl dehydratase 0.9858 1 131
AF-A0A2R7Z1U9-F1-model_v4 FAS1-like dehydratase domain-containing protein 0.9847 1 131
AF-A0A6G7YCF9-F1-model_v4 MaoC family dehydratase 0.9837 40 131
AF-A0A5B7RBK0-F1-model_v4 MaoC family dehydratase 0.9834 4 130

Map