F251731

General Info

Members Datasets Scaffolds Average Seq Length
168 81 167 333

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10004445|rootH1_100044453
Length 357
Sequence MSAWRPTRFRAGPRGRGRADRAFAMNRTLLPIRLLFIALCAASGWLVCYAIREWDDYQAKAAFIGLAIGSLVVLIDIMLKGFSLRGLSAITFGLAVGTVISYMLGHSPLLEKGDPQIIFMVQLALFLVCTYISTVIALRGKDEFNLVIPYVRFVPHEVDVPLMVVDTSALIDGRIARVGQTGFLGAALVIPRFVLKELQTIADSPDPQLQARGRRGLETLGELRKVKTLDLRINESDVSKRENVDAKLVFLAQSMRAKLLTTNYNLIKLAEFHGVVCVNLNTLGKALRPELVTGEILEVELVKPGKEEGQALGYLDDNSLVVVNGARGHIGRVVTVEIVSVLPSSAGKMVFARLMDM

Samples

Sample ID Description Type Environment
1 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
13 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
14 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
15 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
16 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
17 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
18 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
28 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
29 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
30 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
31 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
32 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
33 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
34 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
35 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
36 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
37 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
38 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
39 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
40 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
41 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
42 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
43 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
44 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
45 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
46 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
47 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
48 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
49 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
50 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
51 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
52 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
53 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
54 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
55 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
56 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
57 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
58 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
59 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
60 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
61 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
62 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
63 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
64 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
65 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
66 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
77 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
78 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
80 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
81 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0
Isolates 0.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.19
Nodule 0
Rhizoplane 0
Rhizosphere 91.67
Stem 0
Stem Tuber 0
Unclassified 7.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10007716 3300003316 Bacteria 1554
2 rootH2_10007188 3300003320 Bacteria 50032
3 rootH2_10031179 3300003320 Bacteria 10184
4 rootH2_10099289 3300003320 Bacteria 3708
5 rootL2_10029261 3300003322 Bacteria 2454
6 rootL2_10137102 3300003322 Bacteria 5478
7 rootH1_10004445 3300003323 Bacteria 7107
8 rootH1_10100891 3300003323 Bacteria 7294
9 rootH1_10107419 3300003323 Bacteria 3654
10 rootH1_10206187 3300003323 Bacteria 3846
11 Ga0070683_100010818 3300005329 Bacteria 7853
12 Ga0068869_100000032 3300005334 Bacteria 58379
13 Ga0068868_100005566 3300005338 Bacteria 8859
14 Ga0068868_100263243 3300005338 Bacteria 1455
15 Ga0068868_100301788 3300005338 Unclassified 1360
16 Ga0068867_100002778 3300005459 Bacteria 12313
17 Ga0070679_100006065 3300005530 Bacteria 11247
18 Ga0068856_100049699 3300005614 Bacteria 4133
19 Ga0068856_100110160 3300005614 Bacteria 2750
20 Ga0068863_100406411 3300005841 Bacteria 1332
21 Ga0070712_100181342 3300006175 Bacteria 1641
22 Ga0097621_100001715 3300006237 Bacteria 14978
23 Ga0097621_100271487 3300006237 Unclassified 1490
24 Ga0068871_100000812 3300006358 Bacteria 20978
25 Ga0068865_100001531 3300006881 Bacteria 13500
26 Ga0163163_10120691 3300014325 Bacteria 2655
27 Ga0207652_10004783 3300025921 Bacteria 10975
28 Ga0207704_10001163 3300025938 Bacteria 11723
29 Ga0207689_10000932 3300025942 Bacteria 28064
30 Ga0207661_10035233 3300025944 Bacteria 3898
31 Ga0207677_10171260 3300026023 Bacteria 1698
32 Ga0207702_10002222 3300026078 Bacteria 18606
33 Ga0207702_10046398 3300026078 Bacteria 3657
34 Ga0207648_10005662 3300026089 Bacteria 12543
35 Ga0207674_10016301 3300026116 Bacteria 8138
36 Ga0207683_10429879 3300026121 Bacteria 1216
37 Ga0265337_1000179 3300028556 Bacteria 33387
38 Ga0265337_1003798 3300028556 Bacteria 6436
39 Ga0265337_1019018 3300028556 Bacteria 2173
40 Ga0265337_1055138 3300028556 Bacteria 1111
41 Ga0265319_1000080 3300028563 Bacteria 75462
42 Ga0265319_1001307 3300028563 Bacteria 15068
43 Ga0265319_1001855 3300028563 Bacteria 12046
44 Ga0265319_1016277 3300028563 Bacteria 2854
45 Ga0265334_10035687 3300028573 Bacteria 1966
46 Ga0265334_10062107 3300028573 Bacteria 1406
47 Ga0265318_10000002 3300028577 Bacteria 428208
48 Ga0265318_10000572 3300028577 Bacteria 25957
49 Ga0265318_10001117 3300028577 Bacteria 16775
50 Ga0265318_10007165 3300028577 Bacteria 5067
51 Ga0265318_10008473 3300028577 Bacteria 4574
52 Ga0265318_10012513 3300028577 Bacteria 3611
53 Ga0265318_10019616 3300028577 Bacteria 2740
54 Ga0265323_10000262 3300028653 Bacteria 30876
55 Ga0265323_10001358 3300028653 Bacteria 12101
56 Ga0265323_10038896 3300028653 Bacteria 1736
57 Ga0265322_10000568 3300028654 Bacteria 14112
58 Ga0265322_10001214 3300028654 Bacteria 8771
59 Ga0265322_10001354 3300028654 Bacteria 8108
60 Ga0265336_10001388 3300028666 Bacteria 11165
61 Ga0265336_10002044 3300028666 Bacteria 8604
62 Ga0265338_10000339 3300028800 Bacteria 85119
63 Ga0265338_10001441 3300028800 Bacteria 38613
64 Ga0265338_10010339 3300028800 Bacteria 10959
65 Ga0265338_10046444 3300028800 Bacteria 3979
66 Ga0265324_10002112 3300029957 Bacteria 10480
67 Ga0265324_10015289 3300029957 Bacteria 2824
68 Ga0265324_10051053 3300029957 Bacteria 1421
69 Ga0265330_10099597 3300031235 Unclassified 1245
70 Ga0265332_10019640 3300031238 Bacteria 2983
71 Ga0265320_10001075 3300031240 Bacteria 20165
72 Ga0265320_10002202 3300031240 Bacteria 13703
73 Ga0265320_10009977 3300031240 Bacteria 5680
74 Ga0265320_10019466 3300031240 Bacteria 3709
75 Ga0265320_10083533 3300031240 Bacteria 1488
76 Ga0265320_10133056 3300031240 Bacteria 1129
77 Ga0265325_10031137 3300031241 Bacteria 2857
78 Ga0265329_10011637 3300031242 Unclassified 3193
79 Ga0265340_10055685 3300031247 Bacteria 1904
80 Ga0265339_10008287 3300031249 Bacteria 6621
81 Ga0265331_10013797 3300031250 Bacteria 4332
82 Ga0265327_10000127 3300031251 Bacteria 166247
83 Ga0265327_10003736 3300031251 Bacteria 14158
84 Ga0265327_10005858 3300031251 Bacteria 10051
85 Ga0265327_10009811 3300031251 Bacteria 6842
86 Ga0265327_10010624 3300031251 Bacteria 6445
87 Ga0265327_10041093 3300031251 Bacteria 2496
88 Ga0265316_10023690 3300031344 Bacteria 5153
89 Ga0307408_100000003 3300031548 Bacteria 618438
90 Ga0265313_10000165 3300031595 Bacteria 69129
91 Ga0265313_10001246 3300031595 Bacteria 24276
92 Ga0265313_10002148 3300031595 Bacteria 17539
93 Ga0265313_10007556 3300031595 Bacteria 7389
94 Ga0265313_10015526 3300031595 Bacteria 4426
95 Ga0307508_10000329 3300031616 Bacteria 57297
96 Ga0265314_10002135 3300031711 Bacteria 20737
97 Ga0265314_10003774 3300031711 Bacteria 14479
98 Ga0265314_10042709 3300031711 Bacteria 3230
99 Ga0265314_10096819 3300031711 Unclassified 1908
100 Ga0265314_10111813 3300031711 Bacteria 1734
101 Ga0265342_10001669 3300031712 Bacteria 20378
102 Ga0265342_10020422 3300031712 Bacteria 4248
103 Ga0265342_10023800 3300031712 Unclassified 3870
104 Ga0265342_10029123 3300031712 Bacteria 3432
105 Ga0307410_10000002 3300031852 Bacteria 145309
106 Ga0307409_100000838 3300031995 Bacteria 14182
107 Ga0307416_100000012 3300032002 Bacteria 296814
108 Ga0307411_10165588 3300032005 Bacteria 1661
109 Ga0373951_0015153 3300035091 Bacteria 1735
110 Ga0395905_0000010 3300037471 Bacteria 460729
111 Ga0451577_0000087 3300042876 Bacteria 207662
112 Ga0451577_0007031 3300042876 Bacteria 11100
113 Ga0451577_0095833 3300042876 Bacteria 2649
114 Ga0451577_0242396 3300042876 Unclassified 1631
115 Ga0453683_0001134 3300044673 Bacteria 24237
116 Ga0453684_0000045 3300044712 Bacteria 582917
117 Ga0453684_0010035 3300044712 Bacteria 16296
118 Ga0453684_0013136 3300044712 Bacteria 13506
119 Ga0453684_0086269 3300044712 Bacteria 3896
120 Ga0453684_0268408 3300044712 Bacteria 1951
121 Ga0453684_0491456 3300044712 Bacteria 1360
122 Ga0466968_0064901 3300044735 Unclassified 1580
123 Ga0466959_0138581 3300045049 Bacteria 1721
124 Ga0451576_0000071 3300045051 Bacteria 258795
125 Ga0451576_0003416 3300045051 Bacteria 21841
126 Ga0451576_0029610 3300045051 Bacteria 5858
127 Ga0451576_0153421 3300045051 Bacteria 2402
128 Ga0451576_0176721 3300045051 Bacteria 2229
129 Ga0451576_0258772 3300045051 Bacteria 1819
130 Ga0466967_0179354 3300045976 Bacteria 1997
131 Ga0495636_0118993 3300047318 Bacteria 1167
132 Ga0501032_0000281 3300049569 Bacteria 43046
133 Ga0501032_0002298 3300049569 Bacteria 15002
134 Ga0501032_0046961 3300049569 Unclassified 2917
135 Ga0501033_0010035 3300049570 Bacteria 7270
136 Ga0501033_0011455 3300049570 Bacteria 6785
137 Ga0501033_0069268 3300049570 Bacteria 2593
138 Ga0501034_0067209 3300049571 Bacteria 3598
139 Ga0501034_0141365 3300049571 Bacteria 2386
140 Ga0501036_0130804 3300049572 Unclassified 2119
141 Ga0501037_0019654 3300049573 Bacteria 4983
142 Ga0501037_0094804 3300049573 Bacteria 2158
143 Ga0501038_0048121 3300049574 Bacteria 3691
144 Ga0501039_0012223 3300049575 Bacteria 6544
145 Ga0501043_0162740 3300049579 Bacteria 1743
146 Ga0501043_0170378 3300049579 Bacteria 1698
147 Ga0501046_0003848 3300049580 Bacteria 13736
148 Ga0501046_0008563 3300049580 Bacteria 8903
149 Ga0501046_0011416 3300049580 Bacteria 7595
150 Ga0501046_0014551 3300049580 Bacteria 6632
151 Ga0501046_0129012 3300049580 Bacteria 1918
152 Ga0501047_0034913 3300049581 Bacteria 4855
153 Ga0501047_0094522 3300049581 Unclassified 2868
154 Ga0501048_0041712 3300049582 Bacteria 3286
155 Ga0501048_0213383 3300049582 Unclassified 1369
156 Ga0501080_0085569 3300049742 Bacteria 2930
157 Ga0501083_0001733 3300049744 Bacteria 14864
158 Ga0501083_0002635 3300049744 Bacteria 12355
159 Ga0501083_0123767 3300049744 Bacteria 1695
160 Ga0501035_0000478 3300049822 Bacteria 44866
161 Ga0501035_0006204 3300049822 Bacteria 11245
162 Ga0501035_0065927 3300049822 Bacteria 3214
163 Ga0501044_0000781 3300049823 Bacteria 38616
164 Ga0501044_0001997 3300049823 Bacteria 23564
165 Ga0501044_0088465 3300049823 Unclassified 3126
166 Ga0500642_0137828 3300053130 Bacteria 1144
167 Ga0500622_0037579 3300053156 Bacteria 2529

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026121 Ga0207683_10429879 Ga0207683_104298791 270
2 3300044712 Ga0453684_0000045 Ga0453684_0000045_150043_151059 290
3 3300031251 Ga0265327_10005858 Ga0265327_1000585811 302
4 3300031251 Ga0265327_10041093 Ga0265327_100410934 311
5 3300005530 Ga0070679_100006065 Ga0070679_10000606511 312
6 3300025921 Ga0207652_10004783 Ga0207652_1000478312 312
7 3300031251 Ga0265327_10000127 Ga0265327_1000012731 314
8 3300005614 Ga0068856_100110160 Ga0068856_1001101602 317
9 3300026078 Ga0207702_10002222 Ga0207702_100022223 317
10 3300026116 Ga0207674_10016301 Ga0207674_100163012 317
11 3300042876 Ga0451577_0242396 Ga0451577_0242396_186_1193 321
12 3300045051 Ga0451576_0029610 Ga0451576_0029610_2523_3530 321
13 3300028666 Ga0265336_10002044 Ga0265336_1000204411 322
14 3300044735 Ga0466968_0064901 Ga0466968_0064901_79_1086 322
15 3300028556 Ga0265337_1000179 Ga0265337_100017924 323
16 3300028563 Ga0265319_1001855 Ga0265319_10018553 323
17 3300028563 Ga0265319_1016277 Ga0265319_10162773 323
18 3300028573 Ga0265334_10035687 Ga0265334_100356872 323
19 3300028577 Ga0265318_10000572 Ga0265318_1000057215 323
20 3300028577 Ga0265318_10007165 Ga0265318_100071656 323
21 3300028800 Ga0265338_10000339 Ga0265338_1000033950 323
22 3300028800 Ga0265338_10046444 Ga0265338_100464445 323
23 3300029957 Ga0265324_10002112 Ga0265324_100021127 323
24 3300031238 Ga0265332_10019640 Ga0265332_100196403 323
25 3300031240 Ga0265320_10002202 Ga0265320_100022026 323
26 3300031240 Ga0265320_10019466 Ga0265320_100194664 323
27 3300031241 Ga0265325_10031137 Ga0265325_100311374 323
28 3300031247 Ga0265340_10055685 Ga0265340_100556853 323
29 3300031249 Ga0265339_10008287 Ga0265339_100082874 323
30 3300031595 Ga0265313_10000165 Ga0265313_1000016550 323
31 3300031712 Ga0265342_10020422 Ga0265342_100204223 323
32 3300042876 Ga0451577_0095833 Ga0451577_0095833_350_1363 323
33 3300044712 Ga0453684_0268408 Ga0453684_0268408_596_1609 323
34 3300045051 Ga0451576_0153421 Ga0451576_0153421_912_1925 323
35 3300028556 Ga0265337_1003798 Ga0265337_10037985 324
36 3300028577 Ga0265318_10019616 Ga0265318_100196163 324
37 3300028654 Ga0265322_10001354 Ga0265322_100013545 324
38 3300028666 Ga0265336_10001388 Ga0265336_100013885 324
39 3300028800 Ga0265338_10010339 Ga0265338_1001033911 324
40 3300031251 Ga0265327_10009811 Ga0265327_100098113 324
41 3300031711 Ga0265314_10002135 Ga0265314_100021357 324
42 3300031595 Ga0265313_10001246 Ga0265313_1000124614 326
43 3300044673 Ga0453683_0001134 Ga0453683_0001134_22577_23584 326
44 3300028800 Ga0265338_10001441 Ga0265338_1000144121 328
45 3300028577 Ga0265318_10008473 Ga0265318_100084734 329
46 3300029957 Ga0265324_10051053 Ga0265324_100510533 329
47 3300031595 Ga0265313_10002148 Ga0265313_100021489 329
48 3300031712 Ga0265342_10029123 Ga0265342_100291234 329
49 3300044712 Ga0453684_0491456 Ga0453684_0491456_264_1277 329
50 iso_pu_bacteria 2786546940 2788437688 329
51 3300028653 Ga0265323_10000262 Ga0265323_1000026215 330
52 3300028654 Ga0265322_10001214 Ga0265322_100012144 330
53 3300031344 Ga0265316_10023690 Ga0265316_100236903 330
54 3300031712 Ga0265342_10001669 Ga0265342_1000166913 330
55 3300049744 Ga0501083_0123767 Ga0501083_0123767_51_1064 331
56 3300031616 Ga0307508_10000329 Ga0307508_1000032928 332
57 3300003320 rootH2_10099289 rootH2_100992895 333
58 3300003323 rootH1_10004445 rootH1_100044453 333
59 3300005334 Ga0068869_100000032 Ga0068869_10000003246 333
60 3300005338 Ga0068868_100005566 Ga0068868_1000055669 333
61 3300005338 Ga0068868_100301788 Ga0068868_1003017882 333
62 3300005459 Ga0068867_100002778 Ga0068867_10000277814 333
63 3300006237 Ga0097621_100001715 Ga0097621_1000017159 333
64 3300006237 Ga0097621_100271487 Ga0097621_1002714871 333
65 3300006358 Ga0068871_100000812 Ga0068871_10000081216 333
66 3300006881 Ga0068865_100001531 Ga0068865_1000015315 333
67 3300025938 Ga0207704_10001163 Ga0207704_100011634 333
68 3300025942 Ga0207689_10000932 Ga0207689_100009322 333
69 3300026023 Ga0207677_10171260 Ga0207677_101712602 333
70 3300026089 Ga0207648_10005662 Ga0207648_1000566213 333
71 3300031548 Ga0307408_100000003 Ga0307408_100000003107 333
72 3300031852 Ga0307410_10000002 Ga0307410_1000000271 333
73 3300031995 Ga0307409_100000838 Ga0307409_1000008383 333
74 3300032002 Ga0307416_100000012 Ga0307416_10000001244 333
75 3300032005 Ga0307411_10165588 Ga0307411_101655882 333
76 3300037471 Ga0395905_0000010 Ga0395905_0000010_61785_62786 333
77 3300031240 Ga0265320_10133056 Ga0265320_101330561 334
78 3300031251 Ga0265327_10010624 Ga0265327_100106243 334
79 3300042876 Ga0451577_0007031 Ga0451577_0007031_9964_11013 334
80 3300049569 Ga0501032_0046961 Ga0501032_0046961_311_1342 334
81 3300049570 Ga0501033_0011455 Ga0501033_0011455_5538_6569 334
82 3300049573 Ga0501037_0094804 Ga0501037_0094804_158_1189 334
83 3300049580 Ga0501046_0011416 Ga0501046_0011416_1305_2336 334
84 3300049582 Ga0501048_0213383 Ga0501048_0213383_60_1097 334
85 3300049742 Ga0501080_0085569 Ga0501080_0085569_1390_2421 334
86 3300049822 Ga0501035_0065927 Ga0501035_0065927_1475_2506 334
87 3300049823 Ga0501044_0001997 Ga0501044_0001997_20437_21465 334
88 3300049823 Ga0501044_0088465 Ga0501044_0088465_256_1287 334
89 3300003322 rootL2_10137102 rootL2_101371022 335
90 3300003323 rootH1_10107419 rootH1_101074193 335
91 3300005329 Ga0070683_100010818 Ga0070683_1000108185 335
92 3300005614 Ga0068856_100049699 Ga0068856_1000496993 335
93 3300005841 Ga0068863_100406411 Ga0068863_1004064112 335
94 3300025944 Ga0207661_10035233 Ga0207661_100352335 335
95 3300026078 Ga0207702_10046398 Ga0207702_100463985 335
96 3300028563 Ga0265319_1001307 Ga0265319_100130714 335
97 3300028577 Ga0265318_10012513 Ga0265318_100125133 335
98 3300028653 Ga0265323_10001358 Ga0265323_1000135810 335
99 3300028653 Ga0265323_10038896 Ga0265323_100388962 335
100 3300028654 Ga0265322_10000568 Ga0265322_1000056812 335
101 3300031240 Ga0265320_10083533 Ga0265320_100835333 335
102 3300031242 Ga0265329_10011637 Ga0265329_100116371 335
103 3300031711 Ga0265314_10096819 Ga0265314_100968192 335
104 3300031711 Ga0265314_10111813 Ga0265314_101118132 335
105 3300031712 Ga0265342_10023800 Ga0265342_100238003 335
106 3300035091 Ga0373951_0015153 Ga0373951_0015153_237_1244 335
107 3300044712 Ga0453684_0013136 Ga0453684_0013136_7131_8138 335
108 3300045049 Ga0466959_0138581 Ga0466959_0138581_457_1464 335
109 3300045051 Ga0451576_0000071 Ga0451576_0000071_34877_35884 335
110 3300045051 Ga0451576_0003416 Ga0451576_0003416_904_1911 335
111 3300045051 Ga0451576_0176721 Ga0451576_0176721_1016_2023 335
112 3300049569 Ga0501032_0002298 Ga0501032_0002298_329_1336 335
113 3300049570 Ga0501033_0010035 Ga0501033_0010035_3779_4786 335
114 3300049570 Ga0501033_0069268 Ga0501033_0069268_1107_2114 335
115 3300049571 Ga0501034_0141365 Ga0501034_0141365_1036_2043 335
116 3300049573 Ga0501037_0019654 Ga0501037_0019654_3717_4724 335
117 3300049574 Ga0501038_0048121 Ga0501038_0048121_836_1843 335
118 3300049575 Ga0501039_0012223 Ga0501039_0012223_5405_6412 335
119 3300049579 Ga0501043_0170378 Ga0501043_0170378_491_1498 335
120 3300049580 Ga0501046_0014551 Ga0501046_0014551_388_1395 335
121 3300049580 Ga0501046_0129012 Ga0501046_0129012_888_1895 335
122 3300049581 Ga0501047_0094522 Ga0501047_0094522_56_1096 335
123 3300049582 Ga0501048_0041712 Ga0501048_0041712_879_1886 335
124 3300049744 Ga0501083_0001733 Ga0501083_0001733_8380_9387 335
125 3300049744 Ga0501083_0002635 Ga0501083_0002635_913_1920 335
126 3300049822 Ga0501035_0006204 Ga0501035_0006204_4832_5839 335
127 3300049569 Ga0501032_0000281 Ga0501032_0000281_14026_15036 336
128 3300049572 Ga0501036_0130804 Ga0501036_0130804_885_1895 336
129 3300049579 Ga0501043_0162740 Ga0501043_0162740_82_1092 336
130 3300049580 Ga0501046_0003848 Ga0501046_0003848_9590_10600 336
131 3300049580 Ga0501046_0008563 Ga0501046_0008563_4545_5555 336
132 3300049581 Ga0501047_0034913 Ga0501047_0034913_3136_4146 336
133 3300049822 Ga0501035_0000478 Ga0501035_0000478_38506_39516 336
134 3300049823 Ga0501044_0000781 Ga0501044_0000781_19153_20163 336
135 3300003316 rootH1_10007716 rootH1_100077162 337
136 3300003320 rootH2_10007188 rootH2_100071884 337
137 3300003320 rootH2_10031179 rootH2_1003117914 337
138 3300003322 rootL2_10029261 rootL2_100292612 337
139 3300003323 rootH1_10100891 rootH1_101008914 337
140 3300003323 rootH1_10206187 rootH1_102061872 337
141 3300005338 Ga0068868_100263243 Ga0068868_1002632431 337
142 3300006175 Ga0070712_100181342 Ga0070712_1001813422 337
143 3300014325 Ga0163163_10120691 Ga0163163_101206913 337
144 3300028556 Ga0265337_1019018 Ga0265337_10190182 337
145 3300028556 Ga0265337_1055138 Ga0265337_10551381 337
146 3300028563 Ga0265319_1000080 Ga0265319_100008037 337
147 3300028573 Ga0265334_10062107 Ga0265334_100621072 337
148 3300028577 Ga0265318_10000002 Ga0265318_10000002189 337
149 3300028577 Ga0265318_10001117 Ga0265318_1000111710 337
150 3300029957 Ga0265324_10015289 Ga0265324_100152893 337
151 3300031235 Ga0265330_10099597 Ga0265330_100995971 337
152 3300031240 Ga0265320_10001075 Ga0265320_1000107519 337
153 3300031240 Ga0265320_10009977 Ga0265320_100099774 337
154 3300031250 Ga0265331_10013797 Ga0265331_100137975 337
155 3300031251 Ga0265327_10003736 Ga0265327_1000373610 337
156 3300031595 Ga0265313_10007556 Ga0265313_1000755610 337
157 3300031595 Ga0265313_10015526 Ga0265313_100155265 337
158 3300031711 Ga0265314_10003774 Ga0265314_100037746 337
159 3300031711 Ga0265314_10042709 Ga0265314_100427093 337
160 3300042876 Ga0451577_0000087 Ga0451577_0000087_17364_18377 337
161 3300044712 Ga0453684_0010035 Ga0453684_0010035_1047_2060 337
162 3300044712 Ga0453684_0086269 Ga0453684_0086269_2142_3155 337
163 3300045051 Ga0451576_0258772 Ga0451576_0258772_192_1205 337
164 3300045976 Ga0466967_0179354 Ga0466967_0179354_745_1782 337
165 3300047318 Ga0495636_0118993 Ga0495636_0118993_59_1075 337
166 3300049571 Ga0501034_0067209 Ga0501034_0067209_2313_3326 337
167 3300053130 Ga0500642_0137828 Ga0500642_0137828_13_1026 337
168 3300053156 Ga0500622_0037579 Ga0500622_0037579_671_1684 337

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

163

272

0.94

PF01938

TRAM

TRAM domain

290

349

0.9

Feature Viewer

pLDDT pTM Quality
77.04 0.42 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map