F250813

General Info

Members Datasets Scaffolds Average Seq Length
167 134 334 201

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10018203|Ga0307405_100182033
Length 231
Sequence VEDVAVIEDPAAAEVSLDPIRSRLLAELAVPGSAAMLAGKVGLPRQKVNYHLRTLEQHGLVRLVGERRRGNVTERMMQATAASYVISPTAMASVAPDPDRAPDRLSARWLLALAARLVREVGSLITGGARAQQRVATFAIDGEVRFASPSERAAFAEELTTAVTDLLGRYHSEGGRKHRIVVALHPALDSAAPPAVPDPLTPTPAVTAAQGRQTSAPPGTDLRVERDSEEG

Samples

Sample ID Description Type Environment
1 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
36 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
37 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
55 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
56 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
57 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
58 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
59 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
60 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
61 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
62 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
63 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
64 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
65 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
66 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
67 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
68 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
69 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
70 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
71 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
72 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
73 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
74 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
75 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
76 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
77 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
78 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
79 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
80 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
81 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
82 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
83 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
84 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
85 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
86 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
87 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
88 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
89 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
90 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
91 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
92 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
93 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
94 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
95 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
96 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
97 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
98 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
105 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
106 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
107 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
108 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
109 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
110 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
111 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
112 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
113 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
114 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
115 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
116 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
117 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
118 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
119 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
120 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
121 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
122 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
123 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
124 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
125 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
126 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
127 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
128 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
129 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
130 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
131 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
132 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
133 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
134 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.62
Metatranscriptomes 0
Isolates 8.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.4
Nodule 0.6
Rhizoplane 1.8
Rhizosphere 79.04
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307405_10018203 3300031731 Bacteria 3872
2 JGI24735J21928_10009967 3300002067 Bacteria 3042
3 JGI25406J46586_10000239 3300003203 Bacteria 24550
4 Ga0070683_100000383 3300005329 Bacteria 30748
5 Ga0070670_100675856 3300005331 Bacteria 927
6 Ga0068869_100702439 3300005334 Bacteria 862
7 Ga0070689_100321608 3300005340 Bacteria 1292
8 Ga0070709_10464359 3300005434 Bacteria 956
9 Ga0070714_100024853 3300005435 Bacteria 4937
10 Ga0070714_100090896 3300005435 Bacteria 2674
11 Ga0070713_100066322 3300005436 Bacteria 3035
12 Ga0070713_100099186 3300005436 Bacteria 2520
13 Ga0070679_100555602 3300005530 Bacteria 1092
14 Ga0070684_100002021 3300005535 Bacteria 14921
15 Ga0070686_100609619 3300005544 Bacteria 861
16 Ga0070665_100079101 3300005548 Bacteria 3294
17 Ga0070665_100196767 3300005548 Bacteria 2017
18 Ga0070665_100789365 3300005548 Bacteria 963
19 Ga0070664_100120268 3300005564 Bacteria 2299
20 Ga0068857_100652938 3300005577 Bacteria 997
21 Ga0068856_100648141 3300005614 Bacteria 1077
22 Ga0068859_100092685 3300005617 Bacteria 3072
23 Ga0068859_100131893 3300005617 Bacteria 2570
24 Ga0068864_100421596 3300005618 Bacteria 1272
25 Ga0068863_100091890 3300005841 Bacteria 2878
26 Ga0068862_100018171 3300005844 Bacteria 5854
27 Ga0068862_100253439 3300005844 Bacteria 1605
28 Ga0081538_10017366 3300005981 Bacteria 5465
29 Ga0081539_10000136 3300005985 Bacteria 172211
30 Ga0081539_10003689 3300005985 Bacteria 18317
31 Ga0075428_100057889 3300006844 Bacteria 4243
32 Ga0075429_100410709 3300006880 Bacteria 1186
33 Ga0097620_100092688 3300006931 Bacteria 3072
34 Ga0097620_100131896 3300006931 Bacteria 2570
35 Ga0111539_10964685 3300009094 Bacteria 991
36 Ga0105247_10493708 3300009101 Bacteria 891
37 Ga0114129_10372667 3300009147 Bacteria 1886
38 Ga0114129_10725467 3300009147 Bacteria 1275
39 Ga0105248_10226532 3300009177 Bacteria 2104
40 Ga0105029_105414 3300009984 Bacteria 895
41 Ga0105239_11299173 3300010375 Bacteria 839
42 Ga0157374_11146585 3300013296 Bacteria 798
43 Ga0163163_10013051 3300014325 Bacteria 7587
44 Ga0157380_10794613 3300014326 Bacteria 963
45 Ga0157377_10736747 3300014745 Bacteria 720
46 Ga0157377_10829296 3300014745 Bacteria 685
47 Ga0207688_10387973 3300025901 Bacteria 865
48 Ga0207680_10496836 3300025903 Bacteria 869
49 Ga0207652_10224568 3300025921 Bacteria 1692
50 Ga0207652_10272054 3300025921 Bacteria 1528
51 Ga0207650_10552040 3300025925 Bacteria 966
52 Ga0207700_10033012 3300025928 Bacteria 3700
53 Ga0207700_10485338 3300025928 Bacteria 1092
54 Ga0207664_10008656 3300025929 Bacteria 7114
55 Ga0207664_10031472 3300025929 Bacteria 4059
56 Ga0207664_10299371 3300025929 Bacteria 1415
57 Ga0207711_10870454 3300025941 Bacteria 838
58 Ga0207689_10547517 3300025942 Bacteria 972
59 Ga0207661_10002353 3300025944 Bacteria 13017
60 Ga0207679_10063293 3300025945 Bacteria 2760
61 Ga0207658_10008184 3300025986 Bacteria 7121
62 Ga0207641_10527252 3300026088 Bacteria 1149
63 Ga0207641_10903707 3300026088 Bacteria 877
64 Ga0207676_10236533 3300026095 Bacteria 1636
65 Ga0207674_10639140 3300026116 Bacteria 1027
66 Ga0207674_10647833 3300026116 Bacteria 1020
67 Ga0207675_100669576 3300026118 Bacteria 1045
68 Ga0268266_10066534 3300028379 Bacteria 3117
69 Ga0268266_10072751 3300028379 Bacteria 2982
70 Ga0268265_10400859 3300028380 Bacteria 1268
71 Ga0307517_10046348 3300028786 Bacteria 4539
72 Ga0307517_10177943 3300028786 Bacteria 1380
73 Ga0307515_10043961 3300028794 Bacteria 6924
74 Ga0307515_10065514 3300028794 Bacteria 5053
75 Ga0307511_10064946 3300030521 Bacteria 2738
76 Ga0307512_10016482 3300030522 Bacteria 6821
77 Ga0307512_10021710 3300030522 Bacteria 5784
78 Ga0307512_10044619 3300030522 Bacteria 3641
79 Ga0307512_10075088 3300030522 Bacteria 2476
80 Ga0307513_10006087 3300031456 Bacteria 15831
81 Ga0307509_10005146 3300031507 Bacteria 18362
82 Ga0307509_10196677 3300031507 Bacteria 1859
83 Ga0307508_10017898 3300031616 Bacteria 6440
84 Ga0307508_10018310 3300031616 Bacteria 6367
85 Ga0307516_10510751 3300031730 Bacteria 856
86 Ga0307415_100149313 3300032126 Bacteria 1797
87 Ga0307507_10022976 3300033179 Bacteria 6865
88 Ga0307510_10174498 3300033180 Bacteria 1723
89 Ga0373956_0042768 3300035119 Bacteria 2015
90 Ga0395899_0008235 3300037312 Bacteria 8030
91 Ga0395900_0016488 3300037418 Bacteria 7534
92 Ga0395900_0493666 3300037418 Bacteria 1175
93 Ga0395898_0007844 3300037466 Bacteria 11331
94 Ga0395898_0120220 3300037466 Bacteria 2516
95 Ga0395901_0003180 3300038443 Bacteria 16524
96 Ga0395901_0255937 3300038443 Bacteria 1823
97 Ga0395901_0777736 3300038443 Bacteria 948
98 Ga0466969_0005071 3300044656 Bacteria 7008
99 Ga0466966_0509437 3300044684 Bacteria 724
100 Ga0466961_0005131 3300044693 Bacteria 8244
101 Ga0466961_0064319 3300044693 Bacteria 2331
102 Ga0466971_0000301 3300044719 Bacteria 18981
103 Ga0466971_0260719 3300044719 Bacteria 827
104 Ga0466959_0007643 3300045049 Bacteria 7601
105 Ga0466967_0350525 3300045976 Bacteria 1429
106 Ga0495651_0003717 3300046462 Bacteria 11691
107 Ga0495594_0014665 3300046499 Bacteria 4111
108 Ga0495606_0001145 3300046507 Bacteria 37635
109 Ga0495618_0257377 3300046514 Bacteria 1093
110 Ga0495628_0554701 3300046516 Bacteria 824
111 Ga0495632_0028207 3300046519 Bacteria 2931
112 Ga0495652_0004095 3300046529 Bacteria 14070
113 Ga0495586_0149159 3300046535 Bacteria 1315
114 Ga0495645_0016918 3300046543 Bacteria 5219
115 Ga0495645_0403490 3300046543 Bacteria 870
116 Ga0495668_0001706 3300046616 Bacteria 20297
117 Ga0495625_0000792 3300046660 Bacteria 43853
118 Ga0495635_0001174 3300046663 Bacteria 17457
119 Ga0495623_0009350 3300046679 Bacteria 6366
120 Ga0495646_0155646 3300046680 Bacteria 1268
121 Ga0495600_0222698 3300046809 Bacteria 1206
122 Ga0495674_0849900 3300047319 Bacteria 707
123 Ga0495675_0026443 3300047444 Bacteria 3701
124 Ga0495626_0000552 3300048091 Bacteria 37174
125 Ga0496108_0000058 3300048911 Bacteria 123379
126 Ga0496115_0030342 3300048918 Bacteria 4253
127 Ga0496115_0106437 3300048918 Bacteria 2302
128 Ga0496125_0023526 3300048928 Bacteria 5684
129 Ga0496126_0018914 3300048929 Bacteria 6805
130 Ga0496126_0205644 3300048929 Bacteria 1660
131 Ga0501031_0045558 3300049568 Bacteria 2862
132 Ga0501033_0385107 3300049570 Bacteria 979
133 Ga0501036_0080312 3300049572 Bacteria 2757
134 Ga0501039_0444953 3300049575 Bacteria 1018
135 Ga0501040_0002510 3300049576 Bacteria 11817
136 Ga0501046_0098838 3300049580 Bacteria 2241
137 Ga0501068_0756246 3300049584 Bacteria 636
138 Ga0501074_0003235 3300049590 Bacteria 11508
139 Ga0501075_0057487 3300049591 Bacteria 2929
140 Ga0501077_0120296 3300049593 Bacteria 1664
141 Ga0501080_0927547 3300049742 Bacteria 758
142 Ga0501081_0099058 3300049743 Bacteria 2059
143 Ga0501083_0085220 3300049744 Bacteria 2091
144 Ga0501045_0006799 3300049824 Bacteria 7921
145 nmdc:mga03n38_79422_c1 3300050490 Bacteria 1538
146 Ga0495601_0375853 3300053077 Bacteria 922
147 Ga0495612_0004453 3300053078 Bacteria 5811
148 Ga0495619_0191588 3300053085 Bacteria 1415
149 Ga0500651_0315337 3300053093 Bacteria 894
150 Ga0500641_0038189 3300053096 Bacteria 1929
151 Ga0500652_079644 3300053131 Bacteria 1364
152 Ga0501084_0067333 3300054114 Bacteria 2997
153 Ga0501082_0012413 3300060353 Bacteria 7322
154 2566992394 2565956761 Bacteria 6601618
155 2753074369 2751185734 Bacteria 8863695
156 2753264231 2751185782 Bacteria 11227053
157 2791911803 2791354901 Bacteria 8322202
158 2795797930 2795385472 Bacteria 6627535
159 2867304100 2867302475 Bacteria 7087181
160 2884700249 2884693830 Bacteria 11273186
161 2887484154 2887478801 Bacteria 8972725
162 2895450527 2895442618 Bacteria 11027144
163 2899367690 2899359706 Bacteria 10940472
164 2904539354 2904535858 Bacteria 6308016
165 3003000655 3002998708 Bacteria 11715108
166 8055067626 8055066027 Bacteria 9479577
167 8055416947 8055412473 Bacteria 6257500
168 Ga0307405_10018203
169 JGI24735J21928_10009967
170 JGI25406J46586_10000239
171 Ga0070683_100000383
172 Ga0070670_100675856
173 Ga0068869_100702439
174 Ga0070689_100321608
175 Ga0070709_10464359
176 Ga0070714_100024853
177 Ga0070714_100090896
178 Ga0070713_100066322
179 Ga0070713_100099186
180 Ga0070679_100555602
181 Ga0070684_100002021
182 Ga0070686_100609619
183 Ga0070665_100079101
184 Ga0070665_100196767
185 Ga0070665_100789365
186 Ga0070664_100120268
187 Ga0068857_100652938
188 Ga0068856_100648141
189 Ga0068859_100092685
190 Ga0068859_100131893
191 Ga0068864_100421596
192 Ga0068863_100091890
193 Ga0068862_100018171
194 Ga0068862_100253439
195 Ga0081538_10017366
196 Ga0081539_10000136
197 Ga0081539_10003689
198 Ga0075428_100057889
199 Ga0075429_100410709
200 Ga0097620_100092688
201 Ga0097620_100131896
202 Ga0111539_10964685
203 Ga0105247_10493708
204 Ga0114129_10372667
205 Ga0114129_10725467
206 Ga0105248_10226532
207 Ga0105029_105414
208 Ga0105239_11299173
209 Ga0157374_11146585
210 Ga0163163_10013051
211 Ga0157380_10794613
212 Ga0157377_10736747
213 Ga0157377_10829296
214 Ga0207688_10387973
215 Ga0207680_10496836
216 Ga0207652_10224568
217 Ga0207652_10272054
218 Ga0207650_10552040
219 Ga0207700_10033012
220 Ga0207700_10485338
221 Ga0207664_10008656
222 Ga0207664_10031472
223 Ga0207664_10299371
224 Ga0207711_10870454
225 Ga0207689_10547517
226 Ga0207661_10002353
227 Ga0207679_10063293
228 Ga0207658_10008184
229 Ga0207641_10527252
230 Ga0207641_10903707
231 Ga0207676_10236533
232 Ga0207674_10639140
233 Ga0207674_10647833
234 Ga0207675_100669576
235 Ga0268266_10066534
236 Ga0268266_10072751
237 Ga0268265_10400859
238 Ga0307517_10046348
239 Ga0307517_10177943
240 Ga0307515_10043961
241 Ga0307515_10065514
242 Ga0307511_10064946
243 Ga0307512_10016482
244 Ga0307512_10021710
245 Ga0307512_10044619
246 Ga0307512_10075088
247 Ga0307513_10006087
248 Ga0307509_10005146
249 Ga0307509_10196677
250 Ga0307508_10017898
251 Ga0307508_10018310
252 Ga0307516_10510751
253 Ga0307415_100149313
254 Ga0307507_10022976
255 Ga0307510_10174498
256 Ga0373956_0042768
257 Ga0395899_0008235
258 Ga0395900_0016488
259 Ga0395900_0493666
260 Ga0395898_0007844
261 Ga0395898_0120220
262 Ga0395901_0003180
263 Ga0395901_0255937
264 Ga0395901_0777736
265 Ga0466969_0005071
266 Ga0466966_0509437
267 Ga0466961_0005131
268 Ga0466961_0064319
269 Ga0466971_0000301
270 Ga0466971_0260719
271 Ga0466959_0007643
272 Ga0466967_0350525
273 Ga0495651_0003717
274 Ga0495594_0014665
275 Ga0495606_0001145
276 Ga0495618_0257377
277 Ga0495628_0554701
278 Ga0495632_0028207
279 Ga0495652_0004095
280 Ga0495586_0149159
281 Ga0495645_0016918
282 Ga0495645_0403490
283 Ga0495668_0001706
284 Ga0495625_0000792
285 Ga0495635_0001174
286 Ga0495623_0009350
287 Ga0495646_0155646
288 Ga0495600_0222698
289 Ga0495674_0849900
290 Ga0495675_0026443
291 Ga0495626_0000552
292 Ga0496108_0000058
293 Ga0496115_0030342
294 Ga0496115_0106437
295 Ga0496125_0023526
296 Ga0496126_0018914
297 Ga0496126_0205644
298 Ga0501031_0045558
299 Ga0501033_0385107
300 Ga0501036_0080312
301 Ga0501039_0444953
302 Ga0501040_0002510
303 Ga0501046_0098838
304 Ga0501068_0756246
305 Ga0501074_0003235
306 Ga0501075_0057487
307 Ga0501077_0120296
308 Ga0501080_0927547
309 Ga0501081_0099058
310 Ga0501083_0085220
311 Ga0501045_0006799
312 nmdc:mga03n38_79422_c1
313 Ga0495601_0375853
314 Ga0495612_0004453
315 Ga0495619_0191588
316 Ga0500651_0315337
317 Ga0500641_0038189
318 Ga0500652_079644
319 Ga0501084_0067333
320 Ga0501082_0012413
321 2566992394
322 2753074369
323 2753264231
324 2791911803
325 2795797930
326 2867304100
327 2884700249
328 2887484154
329 2895450527
330 2899367690
331 2904539354
332 3003000655
333 8055067626
334 8055416947

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

17

64

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hob-assembly1.cif.gz_A the crystal structure of the zalpha domain from cyprinid herpes virus 3 0.9649 20 59
3f72-assembly3.cif.gz_E crystal structure of the staphylococcus aureus pi258 cadc metal binding site 2 mutant 0.9443 11 62
3f72-assembly3.cif.gz_F crystal structure of the staphylococcus aureus pi258 cadc metal binding site 2 mutant 0.9231 11 64
4ija-assembly1.cif.gz_B structure of s. aureus methicillin resistance factor mecr2 0.8967 20 79
6cdb-assembly1.cif.gz_A crystal structure of v66l czra in the zn(ii)bound state 0.8792 13 79
ID Description Score Start End Superfamily
4hobA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9649 20 59 1.10.10.10
3tgnA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9562 19 62 1.10.10.10
1ulyA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9364 1 86 1.10.10.10
af_A0A1D6GUD7_307_374_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9305 20 62 1.10.10.10
3f72F00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9231 11 64 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7X7SMM1-F1-model_v4 PBP domain-containing protein 0.9797 11 83
AF-A0A662W1U1-F1-model_v4 HTH arsR-type domain-containing protein 0.9787 18 80 GO:0003700
AF-A0A359HHX7-F1-model_v4 HTH arsR-type domain-containing protein 0.9766 3 86 GO:0003700
AF-A0A1F8SX29-F1-model_v4 HTH arsR-type domain-containing protein 0.9708 1 86 GO:0003700
AF-A0A7C2W246-F1-model_v4 ArsR family transcriptional regulator 0.9659 4 86 GO:0003700
GO:0005509

Map