F250070

General Info

Members Datasets Scaffolds Average Seq Length
167 91 167 241

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100000508|Ga0070679_10000050828
Length 286
Sequence LGLDALQGAAEKQTEAYMKYDEGVSQGATQQDAKNFNSAASSASRHAKVSKRSFAAFDIDGTLIRWQLYHAIADRLVKLGYVDAEAYTSMRSARMDWKNRKQGASFKAYEEELVRVYQEILLSLKPQQMDKAIDSVFEEYKDQVYTYTRKIVAELKEQGYLLFAISGSQIEIIQKIAGHYDFDDAIGTTYIQEGEKYTGESIHYLGRKDEAIKALMKKHGAALEGSIAVGDSTGDIAMLEMVERPIAFNPEEALFKVAQEKGWKVVVERKNMYYELEMRDGKYQLV

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
12 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
13 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
14 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
15 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
16 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
17 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
18 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
19 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
20 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
21 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
22 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
23 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
24 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
25 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
26 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
27 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
45 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
46 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
47 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
48 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
49 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
50 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
51 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
52 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
53 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
54 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
55 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
56 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
57 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
58 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
59 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
60 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
61 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
62 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
63 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
64 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
65 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
66 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
67 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
68 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
69 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
70 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
82 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
83 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
84 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
85 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
86 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
87 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
89 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
90 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
91 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.4
Nodule 0
Rhizoplane 0
Rhizosphere 97.01
Stem 0
Stem Tuber 0
Unclassified 0.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10168937 3300003323 Bacteria 3879
2 Ga0070658_10000036 3300005327 Bacteria 143743
3 Ga0070680_100006719 3300005336 Bacteria 8764
4 Ga0070680_100019436 3300005336 Bacteria 5383
5 Ga0070682_100001508 3300005337 Bacteria 13053
6 Ga0070682_100033756 3300005337 Bacteria 3111
7 Ga0070660_100000035 3300005339 Bacteria 77932
8 Ga0070714_100008745 3300005435 Bacteria 7915
9 Ga0070681_10166208 3300005458 Bacteria 2129
10 Ga0070681_10734545 3300005458 Unclassified 903
11 Ga0070679_100000508 3300005530 Bacteria 33143
12 Ga0070679_100006868 3300005530 Bacteria 10612
13 Ga0070679_100492142 3300005530 Bacteria 1170
14 Ga0070684_100488244 3300005535 Unclassified 1140
15 Ga0068855_100211634 3300005563 Bacteria 2178
16 Ga0068855_100242327 3300005563 Bacteria 2014
17 Ga0068855_100589323 3300005563 Unclassified 1200
18 Ga0068855_101065896 3300005563 Unclassified 846
19 Ga0068857_100002678 3300005577 Bacteria 14627
20 Ga0068857_100038402 3300005577 Bacteria 4241
21 Ga0075366_10001020 3300006195 Bacteria 13735
22 Ga0068871_100297670 3300006358 Bacteria 1415
23 Ga0068871_100752997 3300006358 Unclassified 895
24 Ga0068865_100198277 3300006881 Unclassified 1557
25 Ga0105240_10065264 3300009093 Bacteria 4520
26 Ga0105240_10414346 3300009093 Unclassified 1515
27 Ga0105245_10000001 3300009098 Bacteria 939270
28 Ga0105245_10055667 3300009098 Bacteria 3553
29 Ga0105245_10654836 3300009098 Bacteria 1081
30 Ga0105241_10069346 3300009174 Bacteria 2734
31 Ga0105241_10315818 3300009174 Bacteria 1345
32 Ga0105237_10614322 3300009545 Bacteria 1094
33 Ga0105238_10120547 3300009551 Unclassified 2602
34 Ga0105249_10000281 3300009553 Bacteria 53346
35 Ga0105246_10316609 3300011119 Unclassified 1266
36 Ga0157373_10022900 3300013100 Bacteria 4531
37 Ga0157374_10196085 3300013296 Bacteria 1976
38 Ga0157374_10504081 3300013296 Unclassified 1215
39 Ga0157374_10827043 3300013296 Bacteria 942
40 Ga0157372_10182281 3300013307 Unclassified 2431
41 Ga0157372_10563311 3300013307 Bacteria 1328
42 Ga0157377_10131395 3300014745 Bacteria 1529
43 Ga0157379_10459300 3300014968 Unclassified 1177
44 Ga0207705_10000011 3300025909 Bacteria 517768
45 Ga0207654_10035680 3300025911 Bacteria 2772
46 Ga0207707_10002114 3300025912 Bacteria 17978
47 Ga0207707_10003604 3300025912 Bacteria 13731
48 Ga0207695_10120158 3300025913 Bacteria 2597
49 Ga0207695_10151333 3300025913 Bacteria 2259
50 Ga0207660_10005864 3300025917 Bacteria 7975
51 Ga0207660_10007245 3300025917 Bacteria 7179
52 Ga0207657_10003070 3300025919 Bacteria 17871
53 Ga0207649_10009403 3300025920 Bacteria 5348
54 Ga0207652_10005279 3300025921 Bacteria 10487
55 Ga0207652_10010727 3300025921 Bacteria 7378
56 Ga0207652_10260534 3300025921 Unclassified 1564
57 Ga0207652_10559895 3300025921 Unclassified 1027
58 Ga0207694_10054209 3300025924 Bacteria 3110
59 Ga0207687_10000004 3300025927 Bacteria 841177
60 Ga0207687_10431479 3300025927 Bacteria 1089
61 Ga0207664_10459393 3300025929 Bacteria 1137
62 Ga0207667_10019747 3300025949 Bacteria 7512
63 Ga0207667_10086370 3300025949 Bacteria 3246
64 Ga0207667_10244042 3300025949 Bacteria 1838
65 Ga0207667_10454725 3300025949 Bacteria 1301
66 Ga0207712_10000971 3300025961 Bacteria 20645
67 Ga0207639_10605240 3300026041 Bacteria 1011
68 Ga0207702_10157407 3300026078 Bacteria 2072
69 Ga0207674_10004160 3300026116 Bacteria 17503
70 Ga0207698_10261789 3300026142 Bacteria 1589
71 Ga0265337_1000132 3300028556 Bacteria 37927
72 Ga0265337_1001747 3300028556 Bacteria 10490
73 Ga0265337_1002164 3300028556 Bacteria 9234
74 Ga0265337_1002497 3300028556 Bacteria 8385
75 Ga0265337_1012314 3300028556 Unclassified 2912
76 Ga0265326_10000572 3300028558 Bacteria 13768
77 Ga0265326_10004056 3300028558 Unclassified 4729
78 Ga0265326_10009616 3300028558 Bacteria 2892
79 Ga0265326_10026823 3300028558 Unclassified 1642
80 Ga0265326_10031034 3300028558 Bacteria 1523
81 Ga0265319_1058244 3300028563 Unclassified 1258
82 Ga0265334_10000057 3300028573 Bacteria 80027
83 Ga0265334_10004170 3300028573 Bacteria 6466
84 Ga0265334_10022402 3300028573 Unclassified 2574
85 Ga0265334_10034236 3300028573 Unclassified 2017
86 Ga0265334_10059376 3300028573 Bacteria 1445
87 Ga0265334_10080053 3300028573 Bacteria 1204
88 Ga0265318_10004804 3300028577 Bacteria 6470
89 Ga0265323_10009295 3300028653 Bacteria 4022
90 Ga0265322_10004458 3300028654 Bacteria 4169
91 Ga0265322_10004470 3300028654 Bacteria 4163
92 Ga0265322_10005668 3300028654 Unclassified 3691
93 Ga0265322_10045826 3300028654 Unclassified 1243
94 Ga0265336_10000069 3300028666 Bacteria 89776
95 Ga0265336_10001429 3300028666 Bacteria 10918
96 Ga0265336_10006073 3300028666 Unclassified 4386
97 Ga0265338_10000003 3300028800 Bacteria 733923
98 Ga0265338_10000130 3300028800 Bacteria 137739
99 Ga0265338_10000575 3300028800 Bacteria 64813
100 Ga0265338_10001909 3300028800 Bacteria 32562
101 Ga0265338_10003495 3300028800 Bacteria 22046
102 Ga0265338_10005130 3300028800 Bacteria 17252
103 Ga0265338_10009023 3300028800 Bacteria 11996
104 Ga0265338_10012107 3300028800 Bacteria 9855
105 Ga0265338_10036606 3300028800 Bacteria 4693
106 Ga0265338_10055989 3300028800 Bacteria 3502
107 Ga0265338_10077266 3300028800 Bacteria 2815
108 Ga0265338_10311143 3300028800 Bacteria 1142
109 Ga0265324_10001589 3300029957 Bacteria 12648
110 Ga0265324_10002982 3300029957 Bacteria 8272
111 Ga0265324_10010732 3300029957 Unclassified 3516
112 Ga0265324_10034144 3300029957 Bacteria 1772
113 Ga0265330_10008417 3300031235 Unclassified 4966
114 Ga0265332_10019340 3300031238 Bacteria 3005
115 Ga0265328_10016764 3300031239 Bacteria 2845
116 Ga0265320_10010301 3300031240 Bacteria 5574
117 Ga0265320_10012375 3300031240 Unclassified 4969
118 Ga0265325_10003114 3300031241 Bacteria 10944
119 Ga0265325_10036611 3300031241 Bacteria 2598
120 Ga0265325_10145651 3300031241 Unclassified 1124
121 Ga0265340_10038340 3300031247 Bacteria 2370
122 Ga0265331_10006914 3300031250 Bacteria 6626
123 Ga0265331_10023279 3300031250 Bacteria 3149
124 Ga0265327_10000017 3300031251 Bacteria 445264
125 Ga0265327_10024495 3300031251 Bacteria 3545
126 Ga0265327_10054161 3300031251 Bacteria 2078
127 Ga0265327_10069339 3300031251 Bacteria 1770
128 Ga0265327_10106353 3300031251 Unclassified 1346
129 Ga0265316_10005210 3300031344 Bacteria 12711
130 Ga0265313_10013705 3300031595 Unclassified 4840
131 Ga0265313_10015338 3300031595 Bacteria 4469
132 Ga0265313_10041380 3300031595 Unclassified 2271
133 Ga0265342_10022969 3300031712 Bacteria 3955
134 Ga0395899_0008317 3300037312 Bacteria 7987
135 Ga0395900_0000781 3300037418 Bacteria 42249
136 Ga0395898_0080476 3300037466 Bacteria 3142
137 Ga0395905_0029567 3300037471 Bacteria 5163
138 Ga0395905_0116938 3300037471 Bacteria 2506
139 Ga0395901_0001569 3300038443 Bacteria 23673
140 Ga0501031_0000210 3300049568 Bacteria 33509
141 Ga0501032_0026413 3300049569 Unclassified 3993
142 Ga0501032_0056282 3300049569 Bacteria 2644
143 Ga0501034_0000264 3300049571 Bacteria 94901
144 Ga0501034_0005820 3300049571 Bacteria 13410
145 Ga0501034_0080548 3300049571 Bacteria 3259
146 Ga0501036_0024988 3300049572 Bacteria 5039
147 Ga0501037_0000038 3300049573 Bacteria 121931
148 Ga0501038_0082375 3300049574 Unclassified 2709
149 Ga0501039_0079863 3300049575 Unclassified 2545
150 Ga0501043_0039206 3300049579 Unclassified 3724
151 Ga0501046_0000065 3300049580 Bacteria 116095
152 Ga0501047_0000144 3300049581 Bacteria 86866
153 Ga0501047_0000227 3300049581 Bacteria 66683
154 Ga0501048_0000119 3300049582 Bacteria 45205
155 Ga0501048_0189935 3300049582 Bacteria 1456
156 Ga0501068_0360206 3300049584 Unclassified 935
157 Ga0501070_0020772 3300049586 Bacteria 5508
158 Ga0501073_0029644 3300049589 Bacteria 3910
159 Ga0501074_0101731 3300049590 Bacteria 2057
160 Ga0501080_0004575 3300049742 Bacteria 12329
161 Ga0501276_000131 3300049773 Bacteria 3949
162 Ga0501035_0000486 3300049822 Bacteria 44743
163 Ga0501035_0005875 3300049822 Bacteria 11562
164 Ga0501044_0178945 3300049823 Unclassified 2088
165 nmdc:mga0yw44_160755_c1 3300050492 Bacteria 1470
166 nmdc:mga0k408_33_c1 3300050493 Bacteria 23674
167 Ga0500593_000001 3300053117 Bacteria 784404

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009551 Ga0105238_10120547 Ga0105238_101205472 220
2 3300013100 Ga0157373_10022900 Ga0157373_100229006 228
3 3300028556 Ga0265337_1002497 Ga0265337_10024979 228
4 3300028558 Ga0265326_10026823 Ga0265326_100268232 228
5 3300028573 Ga0265334_10034236 Ga0265334_100342363 228
6 3300028654 Ga0265322_10004458 Ga0265322_100044583 228
7 3300028666 Ga0265336_10006073 Ga0265336_100060735 228
8 3300028800 Ga0265338_10012107 Ga0265338_100121079 228
9 3300029957 Ga0265324_10010732 Ga0265324_100107322 228
10 3300031241 Ga0265325_10145651 Ga0265325_101456512 228
11 3300031251 Ga0265327_10024495 Ga0265327_100244953 228
12 3300031595 Ga0265313_10041380 Ga0265313_100413803 228
13 3300028556 Ga0265337_1000132 Ga0265337_100013215 230
14 3300028653 Ga0265323_10009295 Ga0265323_100092952 232
15 3300009174 Ga0105241_10315818 Ga0105241_103158182 233
16 3300009545 Ga0105237_10614322 Ga0105237_106143222 233
17 3300025924 Ga0207694_10054209 Ga0207694_100542093 233
18 3300005435 Ga0070714_100008745 Ga0070714_1000087458 234
19 3300011119 Ga0105246_10316609 Ga0105246_103166092 234
20 3300025929 Ga0207664_10459393 Ga0207664_104593932 234
21 3300028558 Ga0265326_10000572 Ga0265326_1000057220 234
22 3300028573 Ga0265334_10080053 Ga0265334_100800532 234
23 3300028666 Ga0265336_10000069 Ga0265336_1000006935 234
24 3300028800 Ga0265338_10000130 Ga0265338_1000013029 234
25 3300029957 Ga0265324_10001589 Ga0265324_100015895 234
26 3300031241 Ga0265325_10003114 Ga0265325_100031144 234
27 3300031250 Ga0265331_10023279 Ga0265331_100232793 234
28 3300053117 Ga0500593_000001 Ga0500593_000001_420838_421548 234
29 3300005327 Ga0070658_10000036 Ga0070658_10000036131 235
30 3300005535 Ga0070684_100488244 Ga0070684_1004882442 235
31 3300005563 Ga0068855_100211634 Ga0068855_1002116343 235
32 3300009098 Ga0105245_10055667 Ga0105245_100556672 235
33 3300013296 Ga0157374_10827043 Ga0157374_108270432 235
34 3300025909 Ga0207705_10000011 Ga0207705_10000011464 235
35 3300025949 Ga0207667_10086370 Ga0207667_100863702 235
36 3300006195 Ga0075366_10001020 Ga0075366_100010208 236
37 3300013296 Ga0157374_10504081 Ga0157374_105040812 236
38 3300028573 Ga0265334_10059376 Ga0265334_100593762 236
39 3300031251 Ga0265327_10000017 Ga0265327_10000017388 236
40 3300049569 Ga0501032_0056282 Ga0501032_0056282_1033_1749 236
41 3300049571 Ga0501034_0080548 Ga0501034_0080548_2492_3208 236
42 3300049581 Ga0501047_0000144 Ga0501047_0000144_21503_22219 236
43 3300049582 Ga0501048_0189935 Ga0501048_0189935_403_1119 236
44 3300049584 Ga0501068_0360206 Ga0501068_0360206_31_747 236
45 3300049742 Ga0501080_0004575 Ga0501080_0004575_4295_5011 236
46 3300049822 Ga0501035_0005875 Ga0501035_0005875_1435_2151 236
47 3300049823 Ga0501044_0178945 Ga0501044_0178945_995_1711 236
48 3300050492 nmdc:mga0yw44_160755_c1 nmdc:mga0yw44_160755_c1_672_1388 236
49 3300050493 nmdc:mga0k408_33_c1 nmdc:mga0k408_33_c1_8385_9101 236
50 3300006358 Ga0068871_100297670 Ga0068871_1002976702 237
51 3300014745 Ga0157377_10131395 Ga0157377_101313952 237
52 3300025913 Ga0207695_10151333 Ga0207695_101513333 237
53 3300026041 Ga0207639_10605240 Ga0207639_106052402 237
54 3300028556 Ga0265337_1001747 Ga0265337_10017479 237
55 3300028556 Ga0265337_1002164 Ga0265337_10021646 237
56 3300028558 Ga0265326_10009616 Ga0265326_100096162 237
57 3300028558 Ga0265326_10031034 Ga0265326_100310342 237
58 3300028563 Ga0265319_1058244 Ga0265319_10582442 237
59 3300028573 Ga0265334_10000057 Ga0265334_1000005763 237
60 3300028573 Ga0265334_10004170 Ga0265334_100041708 237
61 3300028654 Ga0265322_10004470 Ga0265322_100044705 237
62 3300028666 Ga0265336_10001429 Ga0265336_1000142910 237
63 3300028800 Ga0265338_10000003 Ga0265338_10000003579 237
64 3300028800 Ga0265338_10003495 Ga0265338_100034959 237
65 3300028800 Ga0265338_10009023 Ga0265338_100090235 237
66 3300028800 Ga0265338_10055989 Ga0265338_100559892 237
67 3300028800 Ga0265338_10077266 Ga0265338_100772662 237
68 3300029957 Ga0265324_10034144 Ga0265324_100341443 237
69 3300031239 Ga0265328_10016764 Ga0265328_100167644 237
70 3300031251 Ga0265327_10054161 Ga0265327_100541612 237
71 3300031251 Ga0265327_10069339 Ga0265327_100693392 237
72 3300031595 Ga0265313_10015338 Ga0265313_100153385 237
73 3300005336 Ga0070680_100006719 Ga0070680_1000067195 238
74 3300005336 Ga0070680_100019436 Ga0070680_1000194362 238
75 3300005337 Ga0070682_100033756 Ga0070682_1000337562 238
76 3300005339 Ga0070660_100000035 Ga0070660_10000003514 238
77 3300005530 Ga0070679_100006868 Ga0070679_1000068684 238
78 3300009098 Ga0105245_10000001 Ga0105245_10000001151 238
79 3300009098 Ga0105245_10654836 Ga0105245_106548362 238
80 3300013296 Ga0157374_10196085 Ga0157374_101960852 238
81 3300025917 Ga0207660_10005864 Ga0207660_100058649 238
82 3300025919 Ga0207657_10003070 Ga0207657_1000307014 238
83 3300025921 Ga0207652_10005279 Ga0207652_100052799 238
84 3300025927 Ga0207687_10000004 Ga0207687_10000004116 238
85 3300025927 Ga0207687_10431479 Ga0207687_104314792 238
86 3300028800 Ga0265338_10005130 Ga0265338_100051309 238
87 3300037312 Ga0395899_0008317 Ga0395899_0008317_6941_7669 238
88 3300037418 Ga0395900_0000781 Ga0395900_0000781_30574_31302 238
89 3300037466 Ga0395898_0080476 Ga0395898_0080476_1405_2133 238
90 3300037471 Ga0395905_0029567 Ga0395905_0029567_2555_3286 238
91 3300037471 Ga0395905_0116938 Ga0395905_0116938_1061_1789 238
92 3300038443 Ga0395901_0001569 Ga0395901_0001569_13591_14319 238
93 3300005458 Ga0070681_10166208 Ga0070681_101662083 239
94 3300005530 Ga0070679_100000508 Ga0070679_10000050828 239
95 3300006358 Ga0068871_100752997 Ga0068871_1007529971 239
96 3300028800 Ga0265338_10036606 Ga0265338_100366063 239
97 3300028800 Ga0265338_10311143 Ga0265338_103111432 239
98 3300031240 Ga0265320_10010301 Ga0265320_100103017 239
99 3300049773 Ga0501276_000131 Ga0501276_000131_1872_2606 239
100 3300005458 Ga0070681_10734545 Ga0070681_107345452 240
101 3300005530 Ga0070679_100492142 Ga0070679_1004921421 240
102 3300005563 Ga0068855_101065896 Ga0068855_1010658961 240
103 3300005577 Ga0068857_100002678 Ga0068857_1000026781 240
104 3300005577 Ga0068857_100038402 Ga0068857_1000384025 240
105 3300009093 Ga0105240_10414346 Ga0105240_104143462 240
106 3300013307 Ga0157372_10182281 Ga0157372_101822814 240
107 3300013307 Ga0157372_10563311 Ga0157372_105633112 240
108 3300014968 Ga0157379_10459300 Ga0157379_104593002 240
109 3300025912 Ga0207707_10002114 Ga0207707_1000211414 240
110 3300025912 Ga0207707_10003604 Ga0207707_100036045 240
111 3300025913 Ga0207695_10120158 Ga0207695_101201584 240
112 3300025917 Ga0207660_10007245 Ga0207660_100072455 240
113 3300025920 Ga0207649_10009403 Ga0207649_100094035 240
114 3300025921 Ga0207652_10010727 Ga0207652_100107276 240
115 3300025921 Ga0207652_10260534 Ga0207652_102605342 240
116 3300025921 Ga0207652_10559895 Ga0207652_105598952 240
117 3300025949 Ga0207667_10019747 Ga0207667_100197477 240
118 3300026116 Ga0207674_10004160 Ga0207674_1000416017 240
119 3300026142 Ga0207698_10261789 Ga0207698_102617892 240
120 3300049571 Ga0501034_0000264 Ga0501034_0000264_88418_89146 240
121 3300006881 Ga0068865_100198277 Ga0068865_1001982771 241
122 3300028556 Ga0265337_1012314 Ga0265337_10123143 241
123 3300028558 Ga0265326_10004056 Ga0265326_100040565 241
124 3300028573 Ga0265334_10022402 Ga0265334_100224022 241
125 3300028577 Ga0265318_10004804 Ga0265318_100048043 241
126 3300028654 Ga0265322_10005668 Ga0265322_100056684 241
127 3300028654 Ga0265322_10045826 Ga0265322_100458262 241
128 3300028800 Ga0265338_10001909 Ga0265338_1000190934 241
129 3300029957 Ga0265324_10002982 Ga0265324_100029827 241
130 3300031235 Ga0265330_10008417 Ga0265330_100084174 241
131 3300031238 Ga0265332_10019340 Ga0265332_100193404 241
132 3300031240 Ga0265320_10012375 Ga0265320_100123755 241
133 3300031241 Ga0265325_10036611 Ga0265325_100366112 241
134 3300031247 Ga0265340_10038340 Ga0265340_100383402 241
135 3300031250 Ga0265331_10006914 Ga0265331_100069147 241
136 3300031251 Ga0265327_10106353 Ga0265327_101063532 241
137 3300031344 Ga0265316_10005210 Ga0265316_1000521014 241
138 3300031595 Ga0265313_10013705 Ga0265313_100137054 241
139 3300031712 Ga0265342_10022969 Ga0265342_100229692 241
140 3300005337 Ga0070682_100001508 Ga0070682_1000015087 242
141 3300005563 Ga0068855_100242327 Ga0068855_1002423272 242
142 3300005563 Ga0068855_100589323 Ga0068855_1005893232 242
143 3300009093 Ga0105240_10065264 Ga0105240_100652642 242
144 3300009174 Ga0105241_10069346 Ga0105241_100693463 242
145 3300009553 Ga0105249_10000281 Ga0105249_1000028117 242
146 3300025911 Ga0207654_10035680 Ga0207654_100356803 242
147 3300025949 Ga0207667_10244042 Ga0207667_102440422 242
148 3300025949 Ga0207667_10454725 Ga0207667_104547252 242
149 3300025961 Ga0207712_10000971 Ga0207712_1000097115 242
150 3300028800 Ga0265338_10000575 Ga0265338_1000057551 242
151 3300049568 Ga0501031_0000210 Ga0501031_0000210_2446_3189 242
152 3300049569 Ga0501032_0026413 Ga0501032_0026413_1848_2591 242
153 3300049571 Ga0501034_0005820 Ga0501034_0005820_10350_11093 242
154 3300049572 Ga0501036_0024988 Ga0501036_0024988_426_1169 242
155 3300049573 Ga0501037_0000038 Ga0501037_0000038_79570_80313 242
156 3300049574 Ga0501038_0082375 Ga0501038_0082375_1327_2070 242
157 3300049575 Ga0501039_0079863 Ga0501039_0079863_1379_2122 242
158 3300049579 Ga0501043_0039206 Ga0501043_0039206_1203_1946 242
159 3300049580 Ga0501046_0000065 Ga0501046_0000065_30117_30860 242
160 3300049581 Ga0501047_0000227 Ga0501047_0000227_52010_52753 242
161 3300049582 Ga0501048_0000119 Ga0501048_0000119_27063_27806 242
162 3300049586 Ga0501070_0020772 Ga0501070_0020772_1956_2699 242
163 3300049589 Ga0501073_0029644 Ga0501073_0029644_945_1688 242
164 3300049590 Ga0501074_0101731 Ga0501074_0101731_699_1442 242
165 3300049822 Ga0501035_0000486 Ga0501035_0000486_7966_8709 242
166 3300003323 rootH1_10168937 rootH1_101689372 245
167 3300026078 Ga0207702_10157407 Ga0207702_101574072 245

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08282

Hydrolase_3

haloacid dehalogenase-like hydrolase

181

261

0.82

PF12710

HAD

haloacid dehalogenase-like hydrolase

55

240

0.75

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

54

242

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qjb-assembly2.cif.gz_B crystal structure of the sugar phosphatase pfhad1 from plasmodium falciparum 0.8861 164 210
4zex-assembly2.cif.gz_B crystal structure of pfhad1 in complex with glyceraldehyde-3-phosphate 0.8849 164 210
4hgr-assembly1.cif.gz_D crystal structure of e56a/k67a mutant of 2-keto-3-deoxy-d-glycero-d-galactonononate-9-phosphate phosphohydrolase from bacteroides thetaiotaomicron 0.8316 100 203
3hyc-assembly3.cif.gz_E crystal structure of e. coli phosphatase yrbi, with mg, tetragonal form 0.8308 108 213
3fvv-assembly1.cif.gz_A the crystal structure of the protein with unknown function from bordetella pertussis tohama i 0.8217 9 224
ID Description Score Start End Superfamily
af_A0A0P0XL78_11_123_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9161 164 203 3.40.50.1000
3fvvB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8876 101 225 3.40.50.1000
af_Q86KT5_213_287_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8578 165 212 3.40.50.1000
3n28A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8346 107 213 3.40.50.1000
3e81A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.818 100 201 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A2M8KYJ0-F1-model_v4 phosphoserine phosphatase (EC 3.1.3.3) 0.9603 2 245 GO:0000287
GO:0005737
GO:0006564
GO:0036424
AF-A0A1F7QPI1-F1-model_v4 phosphoserine phosphatase (EC 3.1.3.3) 0.9586 9 241 GO:0000287
GO:0005737
GO:0006564
GO:0036424
AF-A0A0G0EG95-F1-model_v4 Haloacid dehalogenase, IB family protein 0.9586 6 146
AF-A0A7T9QL89-F1-model_v4 deleted 0.9579 6 232
AF-A0A7T9EX49-F1-model_v4 deleted 0.9573 10 245

Feature Viewer

pLDDT pTM Quality
92.91 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map