F249928

General Info

Members Datasets Scaffolds Average Seq Length
167 111 334 326

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10012179|Ga0070709_100121794
Length 366
Sequence MVAHHQGGEHQGGIVTDPRSAERYTAVTSQREFDTEEGMRRRDLLRGLGTVAIALPTVARAQQADRLRRVGVVMAYTEKDPNGQVQVAGFRQQLQKLGWTEGRNIQIDFRYAADNPTRIRELATELLGMGPDLMVANSNVVTTILQSEVRTIPLVFISVSDPIGSGFVKDLARPGGNVTGFANFQPTMGGKWFEKLHEVAPHVQNVGLVMHPEPPNFGYLGSAETAAASTKLNLVRLDVHNGAEIERVLATMASQPDSGLIVAPNVVTFANGALIVALAARHRLPAIYPFAFFTREGGLLSYGFDAVDQFRQGAIYVNKILRGATPSDLPVQHPTTFELAINLRTAQTLGIAISRELLLLADELIE

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
19 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
20 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
28 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
29 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
53 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
54 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
55 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
56 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
57 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
58 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
59 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
60 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
61 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
62 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
63 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
64 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
65 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
66 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
67 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
68 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
69 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
70 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
71 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
72 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
73 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
74 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
75 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
76 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
77 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
78 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
79 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
80 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
81 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
82 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
83 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
84 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
85 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
86 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
87 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
88 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
89 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
90 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
91 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
92 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
93 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
94 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
95 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
96 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
97 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
98 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
99 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
100 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
101 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
102 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
103 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
104 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
105 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
106 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
107 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
108 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
109 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
110 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
111 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.8
Nodule 0
Rhizoplane 8.98
Rhizosphere 89.22
Stem 0
Stem Tuber 0
Unclassified 7.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10012179 3300005434 Bacteria 4809
2 Ga0070680_100024969 3300005336 Bacteria 4776
3 Ga0070661_100084908 3300005344 Bacteria 2339
4 Ga0070709_10213070 3300005434 Bacteria 1374
5 Ga0070714_100076642 3300005435 Bacteria 2904
6 Ga0070714_100513649 3300005435 Bacteria 1144
7 Ga0070713_100007541 3300005436 Bacteria 7647
8 Ga0070713_100049841 3300005436 Bacteria 3456
9 Ga0070710_10023626 3300005437 Bacteria 3233
10 Ga0070710_10096584 3300005437 Unclassified 1752
11 Ga0070711_100030268 3300005439 Bacteria 3582
12 Ga0070711_100145167 3300005439 Bacteria 1784
13 Ga0070708_100371873 3300005445 Bacteria 1347
14 Ga0070708_100406171 3300005445 Bacteria 1284
15 Ga0070706_100105383 3300005467 Bacteria 2623
16 Ga0070706_100396630 3300005467 Bacteria 1284
17 Ga0070707_100035435 3300005468 Bacteria 4760
18 Ga0070698_100090474 3300005471 Unclassified 3043
19 Ga0070698_100114580 3300005471 Bacteria 2660
20 Ga0070698_100121149 3300005471 Bacteria 2576
21 Ga0070698_100141016 3300005471 Bacteria 2361
22 Ga0070697_100019813 3300005536 Bacteria 5315
23 Ga0070697_100053977 3300005536 Bacteria 3266
24 Ga0070697_100348604 3300005536 Bacteria 1278
25 Ga0068853_100069880 3300005539 Bacteria 3056
26 Ga0070672_100339762 3300005543 Bacteria 1278
27 Ga0081455_10061666 3300005937 Bacteria 3155
28 Ga0081538_10033248 3300005981 Bacteria 3436
29 Ga0070717_10001928 3300006028 Bacteria 14491
30 Ga0070717_10087785 3300006028 Bacteria 2620
31 Ga0075364_10196668 3300006051 Bacteria 1366
32 Ga0070715_10093757 3300006163 Unclassified 1387
33 Ga0070716_100043170 3300006173 Bacteria 2520
34 Ga0070716_100091284 3300006173 Bacteria 1844
35 Ga0070716_100299495 3300006173 Bacteria 1118
36 Ga0070712_100068822 3300006175 Bacteria 2523
37 Ga0075428_100097157 3300006844 Bacteria 3211
38 Ga0075428_100285629 3300006844 Bacteria 1775
39 Ga0075428_100434574 3300006844 Bacteria 1406
40 Ga0075430_100310301 3300006846 Unclassified 1304
41 Ga0075431_100072259 3300006847 Bacteria 3560
42 Ga0075431_100202459 3300006847 Bacteria 2031
43 Ga0075434_100007049 3300006871 Bacteria 10372
44 Ga0075434_100263155 3300006871 Bacteria 1744
45 Ga0075434_100592408 3300006871 Viruses 1128
46 Ga0075429_100142213 3300006880 Bacteria 2100
47 Ga0075435_100123184 3300007076 Bacteria 2165
48 Ga0075435_100163640 3300007076 Bacteria 1875
49 Ga0075435_100312374 3300007076 Bacteria 1345
50 Ga0099794_10001810 3300007265 Bacteria 7631
51 Ga0105247_10146894 3300009101 Bacteria 1550
52 Ga0114129_10226456 3300009147 Bacteria 2520
53 Ga0114129_10258051 3300009147 Bacteria 2337
54 Ga0114129_10482575 3300009147 Unclassified 1622
55 Ga0105248_10040613 3300009177 Bacteria 5216
56 Ga0105237_10206407 3300009545 Bacteria 1965
57 Ga0105249_10716180 3300009553 Bacteria 1061
58 Ga0105246_10395813 3300011119 Bacteria 1146
59 Ga0157378_10523293 3300013297 Bacteria 1188
60 Ga0157375_10549025 3300013308 Bacteria 1317
61 Ga0157375_10618772 3300013308 Bacteria 1241
62 Ga0207692_10013619 3300025898 Bacteria 3532
63 Ga0207710_10105244 3300025900 Bacteria 1335
64 Ga0207685_10031396 3300025905 Bacteria 1902
65 Ga0207684_10018515 3300025910 Bacteria 5962
66 Ga0207684_10059250 3300025910 Bacteria 3251
67 Ga0207684_10103923 3300025910 Bacteria 2429
68 Ga0207693_10026350 3300025915 Bacteria 4601
69 Ga0207693_10062619 3300025915 Bacteria 2914
70 Ga0207693_10153430 3300025915 Bacteria 1812
71 Ga0207663_10006179 3300025916 Bacteria 6104
72 Ga0207663_10056985 3300025916 Bacteria 2460
73 Ga0207660_10358621 3300025917 Bacteria 1169
74 Ga0207646_10139717 3300025922 Bacteria 2181
75 Ga0207700_10011957 3300025928 Bacteria 5567
76 Ga0207700_10037402 3300025928 Bacteria 3515
77 Ga0207664_10047376 3300025929 Bacteria 3376
78 Ga0207664_10071567 3300025929 Bacteria 2794
79 Ga0207706_10425678 3300025933 Bacteria 1150
80 Ga0207665_10023976 3300025939 Bacteria 4021
81 Ga0207665_10223395 3300025939 Unclassified 1381
82 Ga0207711_10012276 3300025941 Bacteria 7122
83 Ga0207668_10409235 3300025972 Bacteria 1149
84 Ga0268264_10153661 3300028381 Bacteria 2066
85 Ga0307416_100120962 3300032002 Bacteria 2333
86 Ga0373926_0016937 3300035083 Bacteria 2497
87 Ga0373956_0015361 3300035119 Bacteria 3205
88 Ga0373943_0001256 3300035170 Bacteria 11345
89 Ga0373946_0046361 3300035171 Bacteria 1801
90 Ga0373935_0044486 3300035692 Bacteria 2798
91 Ga0373927_0221945 3300035695 Bacteria 1241
92 Ga0373947_0038440 3300035725 Bacteria 2843
93 Ga0373947_0145316 3300035725 Bacteria 1524
94 Ga0373937_0020479 3300036401 Bacteria 5930
95 Ga0373937_0168085 3300036401 Bacteria 2057
96 Ga0373925_0062692 3300037068 Bacteria 2796
97 Ga0373925_0302088 3300037068 Unclassified 1292
98 Ga0395898_0210755 3300037466 Bacteria 1853
99 Ga0395905_0439854 3300037471 Bacteria 1201
100 Ga0436361_0321344 3300039447 Bacteria 1074
101 Ga0495603_0196773 3300046455 Bacteria 1165
102 Ga0495582_0264687 3300046473 Bacteria 986
103 Ga0495639_0055138 3300046475 Bacteria 1813
104 Ga0495662_0022541 3300046476 Bacteria 3040
105 Ga0495664_0008735 3300046477 Bacteria 5657
106 Ga0495585_0008208 3300046492 Bacteria 6341
107 Ga0495607_0007401 3300046501 Bacteria 7601
108 Ga0495618_0001009 3300046514 Bacteria 19282
109 Ga0495644_0085834 3300046523 Bacteria 1186
110 Ga0495644_0108647 3300046523 Bacteria 1052
111 Ga0495652_0180563 3300046529 Bacteria 1620
112 Ga0495640_0008882 3300046533 Bacteria 7849
113 Ga0495640_0084348 3300046533 Bacteria 2107
114 Ga0495609_0106865 3300046538 Bacteria 1210
115 Ga0495645_0052974 3300046543 Bacteria 2951
116 Ga0495633_0103041 3300046558 Bacteria 1324
117 Ga0495656_0036103 3300046615 Bacteria 2034
118 Ga0495634_0005906 3300046642 Bacteria 9349
119 Ga0495635_0006141 3300046663 Bacteria 8379
120 Ga0495659_0011171 3300046664 Unclassified 2893
121 Ga0495647_0095193 3300046681 Bacteria 1226
122 Ga0495647_0099060 3300046681 Viruses 1205
123 Ga0495658_0098471 3300046683 Unclassified 1742
124 Ga0495613_0281341 3300046689 Unclassified 1155
125 Ga0495581_0203089 3300047315 Bacteria 1159
126 Ga0495674_0013229 3300047319 Bacteria 7757
127 Ga0495684_0014717 3300047471 Bacteria 6022
128 Ga0495684_0099941 3300047471 Bacteria 2193
129 Ga0496101_0149423 3300048904 Bacteria 1786
130 Ga0496104_0025737 3300048907 Bacteria 5426
131 Ga0496104_0060909 3300048907 Bacteria 3576
132 Ga0496104_0090725 3300048907 Bacteria 2920
133 Ga0496104_0574390 3300048907 Unclassified 1038
134 Ga0496105_0030805 3300048908 Bacteria 4397
135 Ga0496106_0355039 3300048909 Bacteria 1178
136 Ga0496107_0086986 3300048910 Bacteria 2282
137 Ga0496107_0186885 3300048910 Bacteria 1539
138 Ga0496108_0010748 3300048911 Bacteria 7431
139 Ga0496109_0613323 3300048912 Bacteria 1024
140 Ga0496110_0047841 3300048913 Bacteria 3747
141 Ga0496110_0213199 3300048913 Bacteria 1756
142 Ga0496113_0260274 3300048916 Bacteria 1386
143 Ga0496115_0022291 3300048918 Bacteria 4905
144 Ga0501076_0208377 3300049592 Bacteria 1597
145 nmdc:mga00v17_255280_c1 3300050491 Bacteria 1137
146 nmdc:mga0yw44_5175_c1 3300050492 Bacteria 6111
147 nmdc:mga05p37_492679_c1 3300050507 Bacteria 1409
148 nmdc:mga05p37_560417_c1 3300050507 Bacteria 1298
149 nmdc:mga09592_338375_c1 3300050508 Bacteria 1303
150 nmdc:mga06r32_163800_c1 3300050510 Unclassified 2206
151 nmdc:mga06r32_188265_c1 3300050510 Bacteria 2051
152 nmdc:mga06r32_19557_c1 3300050510 Bacteria 6218
153 nmdc:mga0n895_148517_c1 3300050512 Bacteria 2373
154 nmdc:mga0n895_19968_c1 3300050512 Bacteria 6238
155 nmdc:mga0n895_210077_c1 3300050512 Bacteria 1977
156 nmdc:mga0n895_59308_c1 3300050512 Bacteria 3775
157 nmdc:mga0n895_83972_c1 3300050512 Bacteria 3177
158 nmdc:mga0rr50_151365_c1 3300050513 Bacteria 1875
159 nmdc:mga0rr50_214216_c1 3300050513 Bacteria 1588
160 nmdc:mga08x19_188826_c1 3300050514 Bacteria 1409
161 nmdc:mga0a205_84711_c1 3300050515 Bacteria 3062
162 Ga0495601_0000213 3300053077 Bacteria 31125
163 Ga0495601_0052734 3300053077 Bacteria 2569
164 Ga0495612_0001326 3300053078 Bacteria 10200
165 Ga0495619_0005649 3300053085 Bacteria 7929
166 Ga0495619_0079827 3300053085 Bacteria 2201
167 Ga0495619_0299857 3300053085 Unclassified 1113
168 Ga0070709_10012179
169 Ga0070680_100024969
170 Ga0070661_100084908
171 Ga0070709_10213070
172 Ga0070714_100076642
173 Ga0070714_100513649
174 Ga0070713_100007541
175 Ga0070713_100049841
176 Ga0070710_10023626
177 Ga0070710_10096584
178 Ga0070711_100030268
179 Ga0070711_100145167
180 Ga0070708_100371873
181 Ga0070708_100406171
182 Ga0070706_100105383
183 Ga0070706_100396630
184 Ga0070707_100035435
185 Ga0070698_100090474
186 Ga0070698_100114580
187 Ga0070698_100121149
188 Ga0070698_100141016
189 Ga0070697_100019813
190 Ga0070697_100053977
191 Ga0070697_100348604
192 Ga0068853_100069880
193 Ga0070672_100339762
194 Ga0081455_10061666
195 Ga0081538_10033248
196 Ga0070717_10001928
197 Ga0070717_10087785
198 Ga0075364_10196668
199 Ga0070715_10093757
200 Ga0070716_100043170
201 Ga0070716_100091284
202 Ga0070716_100299495
203 Ga0070712_100068822
204 Ga0075428_100097157
205 Ga0075428_100285629
206 Ga0075428_100434574
207 Ga0075430_100310301
208 Ga0075431_100072259
209 Ga0075431_100202459
210 Ga0075434_100007049
211 Ga0075434_100263155
212 Ga0075434_100592408
213 Ga0075429_100142213
214 Ga0075435_100123184
215 Ga0075435_100163640
216 Ga0075435_100312374
217 Ga0099794_10001810
218 Ga0105247_10146894
219 Ga0114129_10226456
220 Ga0114129_10258051
221 Ga0114129_10482575
222 Ga0105248_10040613
223 Ga0105237_10206407
224 Ga0105249_10716180
225 Ga0105246_10395813
226 Ga0157378_10523293
227 Ga0157375_10549025
228 Ga0157375_10618772
229 Ga0207692_10013619
230 Ga0207710_10105244
231 Ga0207685_10031396
232 Ga0207684_10018515
233 Ga0207684_10059250
234 Ga0207684_10103923
235 Ga0207693_10026350
236 Ga0207693_10062619
237 Ga0207693_10153430
238 Ga0207663_10006179
239 Ga0207663_10056985
240 Ga0207660_10358621
241 Ga0207646_10139717
242 Ga0207700_10011957
243 Ga0207700_10037402
244 Ga0207664_10047376
245 Ga0207664_10071567
246 Ga0207706_10425678
247 Ga0207665_10023976
248 Ga0207665_10223395
249 Ga0207711_10012276
250 Ga0207668_10409235
251 Ga0268264_10153661
252 Ga0307416_100120962
253 Ga0373926_0016937
254 Ga0373956_0015361
255 Ga0373943_0001256
256 Ga0373946_0046361
257 Ga0373935_0044486
258 Ga0373927_0221945
259 Ga0373947_0038440
260 Ga0373947_0145316
261 Ga0373937_0020479
262 Ga0373937_0168085
263 Ga0373925_0062692
264 Ga0373925_0302088
265 Ga0395898_0210755
266 Ga0395905_0439854
267 Ga0436361_0321344
268 Ga0495603_0196773
269 Ga0495582_0264687
270 Ga0495639_0055138
271 Ga0495662_0022541
272 Ga0495664_0008735
273 Ga0495585_0008208
274 Ga0495607_0007401
275 Ga0495618_0001009
276 Ga0495644_0085834
277 Ga0495644_0108647
278 Ga0495652_0180563
279 Ga0495640_0008882
280 Ga0495640_0084348
281 Ga0495609_0106865
282 Ga0495645_0052974
283 Ga0495633_0103041
284 Ga0495656_0036103
285 Ga0495634_0005906
286 Ga0495635_0006141
287 Ga0495659_0011171
288 Ga0495647_0095193
289 Ga0495647_0099060
290 Ga0495658_0098471
291 Ga0495613_0281341
292 Ga0495581_0203089
293 Ga0495674_0013229
294 Ga0495684_0014717
295 Ga0495684_0099941
296 Ga0496101_0149423
297 Ga0496104_0025737
298 Ga0496104_0060909
299 Ga0496104_0090725
300 Ga0496104_0574390
301 Ga0496105_0030805
302 Ga0496106_0355039
303 Ga0496107_0086986
304 Ga0496107_0186885
305 Ga0496108_0010748
306 Ga0496109_0613323
307 Ga0496110_0047841
308 Ga0496110_0213199
309 Ga0496113_0260274
310 Ga0496115_0022291
311 Ga0501076_0208377
312 nmdc:mga00v17_255280_c1
313 nmdc:mga0yw44_5175_c1
314 nmdc:mga05p37_492679_c1
315 nmdc:mga05p37_560417_c1
316 nmdc:mga09592_338375_c1
317 nmdc:mga06r32_163800_c1
318 nmdc:mga06r32_188265_c1
319 nmdc:mga06r32_19557_c1
320 nmdc:mga0n895_148517_c1
321 nmdc:mga0n895_19968_c1
322 nmdc:mga0n895_210077_c1
323 nmdc:mga0n895_59308_c1
324 nmdc:mga0n895_83972_c1
325 nmdc:mga0rr50_151365_c1
326 nmdc:mga0rr50_214216_c1
327 nmdc:mga08x19_188826_c1
328 nmdc:mga0a205_84711_c1
329 Ga0495601_0000213
330 Ga0495601_0052734
331 Ga0495612_0001326
332 Ga0495619_0005649
333 Ga0495619_0079827
334 Ga0495619_0299857

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04392

ABC_sub_bind

ABC transporter substrate binding protein

71

365

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.891 31 301
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8909 30 301
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.8908 30 301
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8383 31 301
6k1x-assembly1.cif.gz_A crystal structure of rhodothermus marinus substrate-binding protein at ph 6.0 0.8294 121 292
ID Description Score Start End Superfamily
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8897 124 301 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8872 123 301 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8816 123 301 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8782 124 301 3.40.50.2300
af_P02924_26_131_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8104 141 224 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7V9HTZ8-F1-model_v4 ABC transporter substrate-binding protein 0.9875 197 301
AF-A0A537H7S6-F1-model_v4 ABC transporter substrate-binding protein 0.9814 195 301
AF-A0A537MMK8-F1-model_v4 ABC transporter substrate-binding protein 0.98 124 301
AF-A0A2V7I331-F1-model_v4 ABC transporter substrate-binding protein 0.9717 190 301
AF-A0A537UU52-F1-model_v4 ABC transporter substrate-binding protein 0.9709 135 301

Map