F249913

General Info

Members Datasets Scaffolds Average Seq Length
167 117 334 97

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100130219|Ga0070667_1001302192
Length 97
Sequence MSFQAYLDNIEAKTGLTPRQFIDLARERGLDTPSTKAGAIVDWLKEDYDLGRGHAMALVQVIKKGPKIDAKHVGTTGSHRDASDTLWLDGKATNPAA

Samples

Sample ID Description Type Environment
1 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
2 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
12 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
13 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
14 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
15 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
16 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
17 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
18 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
19 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
20 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
21 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
22 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
23 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
24 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
25 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
26 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
27 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
28 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
29 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
30 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
31 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
32 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
44 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
45 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
46 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
47 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
48 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
49 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
50 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
51 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
52 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
53 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
54 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
55 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
56 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
57 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
58 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
59 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
60 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
61 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
62 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
63 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
64 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
65 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
66 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
67 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
68 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
69 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
70 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
71 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
72 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
73 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
74 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
75 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
76 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
77 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
78 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
79 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
80 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
81 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
82 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
85 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
86 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
89 2643221572 Leifsonia sp. Root60 Isolate Unclassified
90 2643221616 Leifsonia sp. Root227 Isolate Unclassified
91 2643221630 Microbacterium sp. Root322 Isolate Unclassified
92 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
93 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
94 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
95 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
96 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
97 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
98 2808606372 Agromyces sp. 23-23 Isolate Unclassified
99 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
100 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
101 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
102 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
103 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
104 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
105 2919395869 Microbacterium resistens 2980 Isolate Unclassified
106 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
107 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
108 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
109 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
110 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
111 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
112 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
113 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
114 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
115 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
116 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
117 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.64
Metatranscriptomes 2.4
Isolates 17.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.19
Nodule 0
Rhizoplane 2.99
Rhizosphere 59.28
Stem 0
Stem Tuber 0.6
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070667_100130219 3300005367 Bacteria 2195
2 JGI25164J39214_1000746 3300002772 Bacteria 12092
3 JGI25165J46597_1000004 3300003214 Bacteria 667510
4 Ga0006562J51391_1013044 3300003578 Bacteria 12230
5 Ga0006562J51391_1013046 3300003578 Bacteria 6150
6 Ga0070676_10905493 3300005328 Bacteria 657
7 Ga0068869_101468888 3300005334 Bacteria 605
8 Ga0070668_100016953 3300005347 Bacteria 5449
9 Ga0070671_100565755 3300005355 Bacteria 981
10 Ga0070674_100208167 3300005356 Bacteria 1514
11 Ga0070667_100036680 3300005367 Bacteria 4110
12 Ga0070678_101342207 3300005456 Bacteria 666
13 Ga0068859_100699009 3300005617 Bacteria 1105
14 Ga0068863_100319995 3300005841 Bacteria 1507
15 Ga0068860_100036850 3300005843 Bacteria 4683
16 Ga0068862_100105318 3300005844 Bacteria 2472
17 Ga0075364_10162702 3300006051 Bacteria 1507
18 Ga0075364_10747510 3300006051 Bacteria 667
19 Ga0097621_101735984 3300006237 Bacteria 594
20 Ga0097620_100698985 3300006931 Bacteria 1105
21 Ga0105245_13077707 3300009098 Bacteria 517
22 Ga0105243_10596263 3300009148 Bacteria 1063
23 Ga0105248_10620413 3300009177 Bacteria 1220
24 Ga0105249_10692072 3300009553 Bacteria 1079
25 Ga0105246_10911604 3300011119 Bacteria 789
26 Ga0157370_10999212 3300013104 Bacteria 757
27 Ga0157378_10047972 3300013297 Bacteria 3797
28 Ga0157375_10598254 3300013308 Bacteria 1262
29 Ga0163163_13280870 3300014325 Bacteria 504
30 Ga0157380_10367989 3300014326 Bacteria 1352
31 Ga0157380_12874753 3300014326 Bacteria 548
32 Ga0163161_11638465 3300017792 Bacteria 568
33 Ga0207427_100010 3300025231 Bacteria 648610
34 Ga0209437_100433 3300025233 Bacteria 36518
35 Ga0209233_1000001 3300025261 Bacteria 2992747
36 Ga0207655_1115217 3300025728 Bacteria 900
37 Ga0207709_10409891 3300025935 Bacteria 1038
38 Ga0207669_10208422 3300025937 Bacteria 1425
39 Ga0207711_11147914 3300025941 Bacteria 718
40 Ga0207658_10012972 3300025986 Bacteria 5692
41 Ga0207677_11004823 3300026023 Bacteria 756
42 Ga0207703_10655960 3300026035 Bacteria 996
43 Ga0207703_11104458 3300026035 Bacteria 762
44 Ga0207641_10152886 3300026088 Bacteria 2091
45 Ga0207683_10233290 3300026121 Bacteria 1678
46 Ga0268265_10295495 3300028380 Bacteria 1456
47 Ga0268264_10122139 3300028381 Bacteria 2297
48 Ga0307509_10035648 3300031507 Bacteria 5458
49 Ga0307408_100210507 3300031548 Bacteria 1580
50 Ga0307408_100213248 3300031548 Bacteria 1571
51 Ga0307408_100539354 3300031548 Bacteria 1028
52 Ga0307408_101455069 3300031548 Bacteria 647
53 Ga0307405_10194969 3300031731 Bacteria 1466
54 Ga0307413_11023474 3300031824 Bacteria 709
55 Ga0307410_10466809 3300031852 Bacteria 1033
56 Ga0307410_11397440 3300031852 Bacteria 614
57 Ga0307406_10154087 3300031901 Bacteria 1643
58 Ga0307406_10409721 3300031901 Bacteria 1077
59 Ga0307406_10680157 3300031901 Bacteria 857
60 Ga0307406_10930692 3300031901 Bacteria 742
61 Ga0307406_11393423 3300031901 Bacteria 614
62 Ga0307407_10446624 3300031903 Bacteria 938
63 Ga0307407_10828299 3300031903 Bacteria 706
64 Ga0307412_10420068 3300031911 Bacteria 1094
65 Ga0307412_12203693 3300031911 Bacteria 513
66 Ga0307412_12275992 3300031911 Bacteria 505
67 Ga0307409_100078177 3300031995 Bacteria 2661
68 Ga0307409_100124098 3300031995 Bacteria 2193
69 Ga0307409_100847556 3300031995 Bacteria 925
70 Ga0307409_101117351 3300031995 Bacteria 810
71 Ga0307416_100572625 3300032002 Bacteria 1205
72 Ga0307416_100767620 3300032002 Bacteria 1058
73 Ga0307416_101244200 3300032002 Bacteria 850
74 Ga0307416_102368127 3300032002 Bacteria 631
75 Ga0307414_11105908 3300032004 Bacteria 732
76 Ga0307411_10382060 3300032005 Bacteria 1159
77 Ga0307411_11687022 3300032005 Bacteria 586
78 Ga0307415_100369922 3300032126 Bacteria 1213
79 Ga0307415_100522888 3300032126 Bacteria 1042
80 Ga0307415_101901045 3300032126 Bacteria 578
81 Ga0439465_0089064 3300041413 Bacteria 1054
82 Ga0439465_0320113 3300041413 Bacteria 583
83 Ga0451807_0581809 3300041486 Bacteria 940
84 Ga0451835_0909658 3300041492 Bacteria 820
85 Ga0451841_1335844 3300041498 Bacteria 638
86 Ga0451843_0760487 3300041509 Bacteria 1566
87 Ga0451853_3282010 3300041512 Bacteria 879
88 Ga0450888_002416 3300042126 Bacteria 1845
89 Ga0466965_0454143 3300044683 Bacteria 714
90 Ga0466970_0368710 3300044765 Bacteria 816
91 Ga0466958_0230392 3300045836 Bacteria 1183
92 Ga0495627_000468 3300046453 Bacteria 34839
93 Ga0495651_0708332 3300046462 Bacteria 627
94 Ga0495650_0140834 3300046471 Bacteria 873
95 Ga0496105_0154084 3300048908 Bacteria 1888
96 Ga0496109_1610209 3300048912 Bacteria 584
97 Ga0496114_0066842 3300048917 Bacteria 3015
98 Ga0496114_1618759 3300048917 Bacteria 536
99 Ga0496117_0000069 3300048920 Bacteria 246025
100 Ga0496117_0002906 3300048920 Bacteria 20726
101 Ga0496117_0251956 3300048920 Bacteria 962
102 Ga0496117_0324559 3300048920 Bacteria 805
103 Ga0496118_0365560 3300048921 Bacteria 763
104 Ga0496119_0002443 3300048922 Bacteria 20410
105 Ga0496119_0013940 3300048922 Bacteria 6341
106 Ga0496119_0015868 3300048922 Bacteria 5767
107 Ga0496120_0002926 3300048923 Bacteria 16295
108 Ga0496120_0003012 3300048923 Bacteria 15970
109 Ga0496121_0084050 3300048924 Bacteria 2511
110 Ga0496122_0000403 3300048925 Bacteria 91680
111 Ga0496122_0001288 3300048925 Bacteria 41666
112 Ga0496122_0111847 3300048925 Bacteria 1790
113 Ga0496122_0130555 3300048925 Bacteria 1598
114 Ga0496122_0226234 3300048925 Bacteria 1068
115 Ga0496122_0299038 3300048925 Bacteria 869
116 Ga0496123_0000510 3300048926 Bacteria 67563
117 Ga0496123_0002742 3300048926 Bacteria 21085
118 Ga0496124_0000205 3300048927 Bacteria 116897
119 Ga0496124_0026877 3300048927 Bacteria 5180
120 Ga0496125_0000074 3300048928 Bacteria 235549
121 Ga0496125_0001855 3300048928 Bacteria 29146
122 Ga0496125_0004163 3300048928 Bacteria 16860
123 Ga0496125_0005357 3300048928 Bacteria 14313
124 Ga0496126_0002486 3300048929 Bacteria 24805
125 Ga0496126_0047966 3300048929 Bacteria 3908
126 Ga0496126_0076767 3300048929 Bacteria 2963
127 Ga0496126_0298224 3300048929 Bacteria 1331
128 Ga0496126_1079775 3300048929 Bacteria 597
129 Ga0501034_0000777 3300049571 Bacteria 47762
130 Ga0501034_0031282 3300049571 Bacteria 5406
131 Ga0501034_0468464 3300049571 Bacteria 1176
132 Ga0501034_1703977 3300049571 Bacteria 503
133 Ga0501038_0124224 3300049574 Bacteria 2125
134 Ga0501040_0092510 3300049576 Bacteria 2103
135 Ga0495595_0326661 3300053084 Bacteria 773
136 Ga0587094_039331 3300059513 Bacteria 765
137 Ga0587101_048386 3300059623 Bacteria 725
138 2643732641 2643221542 Bacteria 3563959
139 2643877688 2643221572 Bacteria 3614809
140 2644096915 2643221616 Bacteria 4066575
141 2644171444 2643221630 Bacteria 3601215
142 2644384743 2643221669 Bacteria 3611286
143 2723640854 2721755702 Bacteria 4373124
144 2739606293 2739367654 Bacteria 6049412
145 2758227663 2757320536 Bacteria 3629334
146 2774398189 2773857763 Bacteria 4180068
147 2808629944 2808606306 Bacteria 3608896
148 2808903321 2808606372 Bacteria 4649509
149 2812363531 2811994880 Bacteria 4147780
150 2839987354 2839986021 Bacteria 3685650
151 2852647650 2852646457 Bacteria 3408613
152 2852664005 2852663356 Bacteria 4090475
153 2884765878 2884763398 Bacteria 4091164
154 2895662526 2895660088 Bacteria 3782833
155 2919397151 2919395869 Bacteria 3704152
156 2919443869 2919443155 Bacteria 4072969
157 2935410318 2935409751 Bacteria 4179611
158 2945968816 2945968032 Bacteria 4111363
159 2946006389 2946003308 Bacteria 3857229
160 2946045273 2946041624 Bacteria 4191385
161 2974296208 2974294766 Bacteria 3767688
162 2974327557 2974324384 Bacteria 3750535
163 2977267938 2977264416 Bacteria 3750737
164 3003002960 3002998708 Bacteria 11715108
165 8016256442 8016254467 Bacteria 3797036
166 8045833862 8045830549 Bacteria 4444727
167 8046355334 8046352972 Bacteria 3613806
168 Ga0070667_100130219
169 JGI25164J39214_1000746
170 JGI25165J46597_1000004
171 Ga0006562J51391_1013044
172 Ga0006562J51391_1013046
173 Ga0070676_10905493
174 Ga0068869_101468888
175 Ga0070668_100016953
176 Ga0070671_100565755
177 Ga0070674_100208167
178 Ga0070667_100036680
179 Ga0070678_101342207
180 Ga0068859_100699009
181 Ga0068863_100319995
182 Ga0068860_100036850
183 Ga0068862_100105318
184 Ga0075364_10162702
185 Ga0075364_10747510
186 Ga0097621_101735984
187 Ga0097620_100698985
188 Ga0105245_13077707
189 Ga0105243_10596263
190 Ga0105248_10620413
191 Ga0105249_10692072
192 Ga0105246_10911604
193 Ga0157370_10999212
194 Ga0157378_10047972
195 Ga0157375_10598254
196 Ga0163163_13280870
197 Ga0157380_10367989
198 Ga0157380_12874753
199 Ga0163161_11638465
200 Ga0207427_100010
201 Ga0209437_100433
202 Ga0209233_1000001
203 Ga0207655_1115217
204 Ga0207709_10409891
205 Ga0207669_10208422
206 Ga0207711_11147914
207 Ga0207658_10012972
208 Ga0207677_11004823
209 Ga0207703_10655960
210 Ga0207703_11104458
211 Ga0207641_10152886
212 Ga0207683_10233290
213 Ga0268265_10295495
214 Ga0268264_10122139
215 Ga0307509_10035648
216 Ga0307408_100210507
217 Ga0307408_100213248
218 Ga0307408_100539354
219 Ga0307408_101455069
220 Ga0307405_10194969
221 Ga0307413_11023474
222 Ga0307410_10466809
223 Ga0307410_11397440
224 Ga0307406_10154087
225 Ga0307406_10409721
226 Ga0307406_10680157
227 Ga0307406_10930692
228 Ga0307406_11393423
229 Ga0307407_10446624
230 Ga0307407_10828299
231 Ga0307412_10420068
232 Ga0307412_12203693
233 Ga0307412_12275992
234 Ga0307409_100078177
235 Ga0307409_100124098
236 Ga0307409_100847556
237 Ga0307409_101117351
238 Ga0307416_100572625
239 Ga0307416_100767620
240 Ga0307416_101244200
241 Ga0307416_102368127
242 Ga0307414_11105908
243 Ga0307411_10382060
244 Ga0307411_11687022
245 Ga0307415_100369922
246 Ga0307415_100522888
247 Ga0307415_101901045
248 Ga0439465_0089064
249 Ga0439465_0320113
250 Ga0451807_0581809
251 Ga0451835_0909658
252 Ga0451841_1335844
253 Ga0451843_0760487
254 Ga0451853_3282010
255 Ga0450888_002416
256 Ga0466965_0454143
257 Ga0466970_0368710
258 Ga0466958_0230392
259 Ga0495627_000468
260 Ga0495651_0708332
261 Ga0495650_0140834
262 Ga0496105_0154084
263 Ga0496109_1610209
264 Ga0496114_0066842
265 Ga0496114_1618759
266 Ga0496117_0000069
267 Ga0496117_0002906
268 Ga0496117_0251956
269 Ga0496117_0324559
270 Ga0496118_0365560
271 Ga0496119_0002443
272 Ga0496119_0013940
273 Ga0496119_0015868
274 Ga0496120_0002926
275 Ga0496120_0003012
276 Ga0496121_0084050
277 Ga0496122_0000403
278 Ga0496122_0001288
279 Ga0496122_0111847
280 Ga0496122_0130555
281 Ga0496122_0226234
282 Ga0496122_0299038
283 Ga0496123_0000510
284 Ga0496123_0002742
285 Ga0496124_0000205
286 Ga0496124_0026877
287 Ga0496125_0000074
288 Ga0496125_0001855
289 Ga0496125_0004163
290 Ga0496125_0005357
291 Ga0496126_0002486
292 Ga0496126_0047966
293 Ga0496126_0076767
294 Ga0496126_0298224
295 Ga0496126_1079775
296 Ga0501034_0000777
297 Ga0501034_0031282
298 Ga0501034_0468464
299 Ga0501034_1703977
300 Ga0501038_0124224
301 Ga0501040_0092510
302 Ga0495595_0326661
303 Ga0587094_039331
304 Ga0587101_048386
305 2643732641
306 2643877688
307 2644096915
308 2644171444
309 2644384743
310 2723640854
311 2739606293
312 2758227663
313 2774398189
314 2808629944
315 2808903321
316 2812363531
317 2839987354
318 2852647650
319 2852664005
320 2884765878
321 2895662526
322 2919397151
323 2919443869
324 2935410318
325 2945968816
326 2946006389
327 2946045273
328 2974296208
329 2974327557
330 2977267938
331 3003002960
332 8016256442
333 8045833862
334 8046355334

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14117

DUF4287

Domain of unknown function (DUF4287)

2

64

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ezx-assembly1.cif.gz_A solution structure of human barrier-to-autointegration factor baf, nmr, regularized mean structure 0.6787 19 61
2p0w-assembly2.cif.gz_B human histone acetyltransferase 1 (hat1) 0.629 19 62
8esd-assembly1.cif.gz_N crystal structure of commd7-commd9-commd5-commd10 tetramer 0.562 3 63
4ejz-assembly2.cif.gz_B structure of mbogg1 in complex with low affinity dna ligand 0.5557 32 66
2jhj-assembly2.cif.gz_B 3-methyladenine dna-glycosylase from archaeoglobus fulgidus 0.5323 32 61
ID Description Score Start End Superfamily
af_O62112_145_346_1.10.565.10 Mainly Alpha;Orthogonal Bundle;Retinoid X Receptor;Retinoid X Receptor 0.8091 36 64 1.10.565.10
1qckA00 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Barrier-to-autointegration factor, BAF 0.6972 19 61 1.10.150.40
af_A0A2R8PZA4_244_296_1.10.10.2100 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Nucleophosmin, C-terminal domain 0.679 18 61 1.10.10.2100
af_Q76NP9_1_134_1.25.40.180 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; 0.6591 33 60 1.25.40.180
2jhnB02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.6512 32 60 1.10.340.30
ID Description Score Start End GO Terms
AF-A0A7J9UYT5-F1-model_v4 DUF4287 domain-containing protein 0.9801 1 95
AF-A0A542ZX10-F1-model_v4 Uncharacterized protein DUF4287 0.9706 1 95
AF-A0A7J9UYT5-F1-model_v4 DUF4287 domain-containing protein 0.97 1 95
AF-A0A150H5X0-F1-model_v4 DUF4287 domain-containing protein 0.9651 1 95
AF-A3TPK8-F1-model_v4 Valyl-tRNA synthetase 0.9651 1 91

Map