F249810

General Info

Members Datasets Scaffolds Average Seq Length
167 130 167 129

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100446673|Ga0070680_1004466732
Length 135
Sequence MTLDSSAVLAVLFSEPGYLDVVDRMLEAEVLRIGTPTLVEAGVVFASRRGSGSGAQARQLDAVHELIKELGVTVVPFGEPEWHRAVEAFVRFGRGRHKANLNFGDCLAYATAAVANDTLLYVGNDFRHTDIAPAR

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
82 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
83 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
84 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
85 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
86 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
91 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
92 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
93 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
94 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
95 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
96 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
101 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
102 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
103 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
104 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
105 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
106 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
107 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
108 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
109 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
110 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
111 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
112 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
113 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
114 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
115 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
116 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
117 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
118 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
119 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
120 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
123 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
124 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
125 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
126 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
127 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
128 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
129 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
130 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.6
Nodule 0
Rhizoplane 0
Rhizosphere 97.6
Stem 0
Stem Tuber 0
Unclassified 1.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10019931 3300005290 Bacteria 2086
2 Ga0070658_10016793 3300005327 Bacteria 5860
3 Ga0070670_101561749 3300005331 Unclassified 606
4 Ga0070680_100063692 3300005336 Bacteria 3021
5 Ga0070680_100446673 3300005336 Bacteria 1104
6 Ga0070660_100002684 3300005339 Bacteria 12227
7 Ga0070689_100855557 3300005340 Bacteria 802
8 Ga0070687_100476552 3300005343 Bacteria 835
9 Ga0070692_10763004 3300005345 Bacteria 657
10 Ga0070668_100291887 3300005347 Bacteria 1365
11 Ga0070669_100186311 3300005353 Unclassified 1626
12 Ga0070671_100383622 3300005355 Unclassified 1201
13 Ga0070674_100269118 3300005356 Bacteria 1346
14 Ga0070688_100109364 3300005365 Bacteria 1836
15 Ga0070688_100228538 3300005365 Bacteria 1315
16 Ga0070688_101553657 3300005365 Bacteria 539
17 Ga0070710_10506524 3300005437 Bacteria 827
18 Ga0070701_10452052 3300005438 Unclassified 825
19 Ga0070700_100164491 3300005441 Bacteria 1530
20 Ga0070700_101034507 3300005441 Bacteria 677
21 Ga0070708_100194412 3300005445 Bacteria 1898
22 Ga0070662_100106688 3300005457 Bacteria 2128
23 Ga0070681_10015821 3300005458 Bacteria 7519
24 Ga0070681_10066771 3300005458 Bacteria 3566
25 Ga0068867_100989394 3300005459 Viruses 762
26 Ga0070685_10019983 3300005466 Unclassified 3621
27 Ga0070698_100861313 3300005471 Bacteria 851
28 Ga0070699_100120588 3300005518 Bacteria 2306
29 Ga0070699_101340996 3300005518 Unclassified 656
30 Ga0070679_100770552 3300005530 Unclassified 905
31 Ga0070684_100638132 3300005535 Bacteria 991
32 Ga0070697_100013401 3300005536 Bacteria 6430
33 Ga0070672_100484134 3300005543 Bacteria 1069
34 Ga0070686_100283287 3300005544 Bacteria 1223
35 Ga0068855_100135898 3300005563 Bacteria 2805
36 Ga0068857_100615561 3300005577 Bacteria 1027
37 Ga0068852_100366857 3300005616 Bacteria 1410
38 Ga0068852_101571627 3300005616 Bacteria 680
39 Ga0068859_100582235 3300005617 Bacteria 1213
40 Ga0068859_100630960 3300005617 Bacteria 1164
41 Ga0068864_100862243 3300005618 Bacteria 893
42 Ga0068861_100136121 3300005719 Bacteria 1999
43 Ga0068870_10412859 3300005840 Bacteria 881
44 Ga0068858_100460795 3300005842 Unclassified 1226
45 Ga0068862_100817026 3300005844 Unclassified 911
46 Ga0075428_102347498 3300006844 Unclassified 548
47 Ga0075430_100052005 3300006846 Bacteria 3450
48 Ga0075433_10971797 3300006852 Bacteria 740
49 Ga0075429_100386760 3300006880 Unclassified 1225
50 Ga0075429_100386946 3300006880 Bacteria 1225
51 Ga0075429_100556044 3300006880 Unclassified 1006
52 Ga0097620_100582261 3300006931 Bacteria 1213
53 Ga0097620_100630882 3300006931 Bacteria 1164
54 Ga0105240_10032604 3300009093 Bacteria 6744
55 Ga0105240_10198557 3300009093 Bacteria 2353
56 Ga0105240_11155137 3300009093 Unclassified 822
57 Ga0111539_10004119 3300009094 Bacteria 19078
58 Ga0111539_10071815 3300009094 Bacteria 4083
59 Ga0111539_10306644 3300009094 Bacteria 1847
60 Ga0111539_10392145 3300009094 Bacteria 1617
61 Ga0111539_11515808 3300009094 Archaea 778
62 Ga0105245_11887951 3300009098 Bacteria 650
63 Ga0114129_11681079 3300009147 Bacteria 775
64 Ga0105241_10255462 3300009174 Bacteria 1487
65 Ga0105248_10574748 3300009177 Bacteria 1272
66 Ga0105238_10010384 3300009551 Bacteria 9344
67 Ga0105249_10831357 3300009553 Unclassified 988
68 Ga0105249_12621561 3300009553 Bacteria 576
69 Ga0105239_10078843 3300010375 Bacteria 3624
70 Ga0105239_10381549 3300010375 Bacteria 1593
71 Ga0157370_10015306 3300013104 Bacteria 7803
72 Ga0157369_10008378 3300013105 Bacteria 11857
73 Ga0157374_11410816 3300013296 Bacteria 719
74 Ga0157374_11736178 3300013296 Bacteria 649
75 Ga0157372_10559290 3300013307 Bacteria 1333
76 Ga0157375_10464518 3300013308 Bacteria 1431
77 Ga0157380_10087206 3300014326 Unclassified 2566
78 Ga0157379_10568566 3300014968 Bacteria 1056
79 Ga0213875_10015619 3300021388 Bacteria 3694
80 Ga0207707_10664729 3300025912 Bacteria 877
81 Ga0207695_10079854 3300025913 Bacteria 3314
82 Ga0207660_10516090 3300025917 Bacteria 970
83 Ga0207662_10477736 3300025918 Bacteria 856
84 Ga0207657_10001567 3300025919 Bacteria 24544
85 Ga0207652_10941231 3300025921 Unclassified 762
86 Ga0207681_10669518 3300025923 Bacteria 861
87 Ga0207681_10870793 3300025923 Unclassified 754
88 Ga0207644_10550836 3300025931 Bacteria 955
89 Ga0207706_10099962 3300025933 Unclassified 2552
90 Ga0207691_10214234 3300025940 Bacteria 1672
91 Ga0207712_10650388 3300025961 Unclassified 916
92 Ga0207703_10045520 3300026035 Bacteria 3530
93 Ga0207708_10176389 3300026075 Bacteria 1695
94 Ga0207708_10408928 3300026075 Bacteria 1123
95 Ga0207641_11555258 3300026088 Unclassified 663
96 Ga0207648_10330992 3300026089 Bacteria 1370
97 Ga0207675_100251325 3300026118 Bacteria 1711
98 Ga0207698_10031678 3300026142 Bacteria 3820
99 Ga0207428_10045534 3300027907 Bacteria 3532
100 Ga0207428_10124928 3300027907 Unclassified 1971
101 Ga0207428_10625689 3300027907 Bacteria 774
102 Ga0268265_10767259 3300028380 Bacteria 937
103 Ga0268265_11315356 3300028380 Viruses 723
104 Ga0265336_10142072 3300028666 Unclassified 714
105 Ga0265338_10114554 3300028800 Bacteria 2163
106 Ga0265338_10228982 3300028800 Bacteria 1383
107 Ga0265332_10202790 3300031238 Unclassified 824
108 Ga0265328_10070268 3300031239 Unclassified 1287
109 Ga0265320_10002539 3300031240 Bacteria 12680
110 Ga0265325_10038059 3300031241 Unclassified 2541
111 Ga0265325_10203859 3300031241 Bacteria 911
112 Ga0265340_10110214 3300031247 Unclassified 1273
113 Ga0265339_10055884 3300031249 Unclassified 2139
114 Ga0265331_10007746 3300031250 Bacteria 6170
115 Ga0265316_10563664 3300031344 Bacteria 810
116 Ga0307408_101707817 3300031548 Bacteria 600
117 Ga0265313_10153565 3300031595 Unclassified 982
118 Ga0265314_10063471 3300031711 Unclassified 2506
119 Ga0265314_10159307 3300031711 Bacteria 1375
120 Ga0265314_10458908 3300031711 Bacteria 677
121 Ga0373934_0000923 3300035086 Bacteria 10620
122 Ga0373957_0002948 3300035120 Bacteria 4933
123 Ga0373955_0002190 3300035172 Bacteria 8469
124 Ga0373933_0926603 3300035724 Unclassified 574
125 Ga0373937_0000586 3300036401 Bacteria 32331
126 Ga0373925_0873790 3300037068 Unclassified 741
127 Ga0395899_0529876 3300037312 Unclassified 760
128 Ga0395905_0664643 3300037471 Bacteria 944
129 Ga0395905_0838908 3300037471 Bacteria 822
130 Ga0436364_1356050 3300037853 Bacteria 6078
131 Ga0436364_1488628 3300037853 Bacteria 828
132 Ga0495592_0781941 3300046454 Bacteria 568
133 Ga0495603_0683486 3300046455 Bacteria 587
134 Ga0495629_0824796 3300046459 Unclassified 611
135 Ga0495651_0035424 3300046462 Bacteria 3885
136 Ga0495653_0948082 3300046463 Unclassified 511
137 Ga0495580_0000494 3300046472 Bacteria 32970
138 Ga0495594_0270925 3300046499 Bacteria 967
139 Ga0495618_0258493 3300046514 Unclassified 1091
140 Ga0495630_0660653 3300046517 Unclassified 800
141 Ga0495645_0686219 3300046543 Unclassified 623
142 Ga0495667_0269418 3300046559 Bacteria 1082
143 Ga0495635_0560949 3300046663 Unclassified 748
144 Ga0495599_0253023 3300046678 Bacteria 1072
145 Ga0495647_0310978 3300046681 Bacteria 712
146 Ga0495658_0208663 3300046683 Unclassified 1220
147 Ga0495674_0015069 3300047319 Bacteria 7235
148 Ga0495680_0195359 3300047322 Bacteria 1454
149 Ga0495675_0055667 3300047444 Unclassified 2509
150 Ga0495684_0076063 3300047471 Unclassified 2550
151 Ga0501040_0625757 3300049576 Bacteria 778
152 Ga0501042_0255464 3300049578 Bacteria 1265
153 Ga0501075_0561497 3300049591 Bacteria 871
154 Ga0501076_0185426 3300049592 Unclassified 1697
155 Ga0501076_0849243 3300049592 Bacteria 753
156 Ga0501077_0510501 3300049593 Bacteria 771
157 nmdc:mga09592_1049052_c1 3300050508 Unclassified 679
158 nmdc:mga09592_309957_c1 3300050508 Unclassified 1368
159 nmdc:mga09592_432054_c1 3300050508 Bacteria 1137
160 nmdc:mga0qj67_86281_c1 3300050509 Bacteria 2518
161 nmdc:mga08y16_1417083_c1 3300050511 Bacteria 658
162 nmdc:mga08y16_181737_c1 3300050511 Unclassified 2184
163 nmdc:mga08y16_28933_c1 3300050511 Bacteria 5841
164 nmdc:mga08y16_842597_c1 3300050511 Unclassified 907
165 Ga0495619_0310497 3300053085 Unclassified 1092
166 Ga0500646_0200682 3300053090 Unclassified 684
167 Ga0501082_0944633 3300060353 Unclassified 754

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046663 Ga0495635_0560949 Ga0495635_0560949_406_738 108
2 3300037853 Ga0436364_1488628 Ga0436364_1488628_72_473 125
3 3300049576 Ga0501040_0625757 Ga0501040_0625757_188_589 126
4 3300049578 Ga0501042_0255464 Ga0501042_0255464_630_1031 126
5 3300049591 Ga0501075_0561497 Ga0501075_0561497_376_777 126
6 3300049592 Ga0501076_0185426 Ga0501076_0185426_73_474 126
7 3300049592 Ga0501076_0849243 Ga0501076_0849243_98_502 126
8 3300049593 Ga0501077_0510501 Ga0501077_0510501_318_719 126
9 3300005290 Ga0065712_10019931 Ga0065712_100199311 128
10 3300005327 Ga0070658_10016793 Ga0070658_100167935 128
11 3300005331 Ga0070670_101561749 Ga0070670_1015617491 128
12 3300005336 Ga0070680_100063692 Ga0070680_1000636923 128
13 3300005336 Ga0070680_100446673 Ga0070680_1004466732 128
14 3300005339 Ga0070660_100002684 Ga0070660_1000026847 128
15 3300005340 Ga0070689_100855557 Ga0070689_1008555572 128
16 3300005343 Ga0070687_100476552 Ga0070687_1004765522 128
17 3300005345 Ga0070692_10763004 Ga0070692_107630041 128
18 3300005347 Ga0070668_100291887 Ga0070668_1002918872 128
19 3300005353 Ga0070669_100186311 Ga0070669_1001863113 128
20 3300005355 Ga0070671_100383622 Ga0070671_1003836222 128
21 3300005356 Ga0070674_100269118 Ga0070674_1002691182 128
22 3300005365 Ga0070688_100109364 Ga0070688_1001093643 128
23 3300005365 Ga0070688_100228538 Ga0070688_1002285383 128
24 3300005365 Ga0070688_101553657 Ga0070688_1015536571 128
25 3300005437 Ga0070710_10506524 Ga0070710_105065242 128
26 3300005438 Ga0070701_10452052 Ga0070701_104520522 128
27 3300005441 Ga0070700_100164491 Ga0070700_1001644912 128
28 3300005441 Ga0070700_101034507 Ga0070700_1010345072 128
29 3300005445 Ga0070708_100194412 Ga0070708_1001944121 128
30 3300005457 Ga0070662_100106688 Ga0070662_1001066883 128
31 3300005458 Ga0070681_10015821 Ga0070681_1001582111 128
32 3300005458 Ga0070681_10066771 Ga0070681_100667714 128
33 3300005459 Ga0068867_100989394 Ga0068867_1009893941 128
34 3300005466 Ga0070685_10019983 Ga0070685_100199833 128
35 3300005471 Ga0070698_100861313 Ga0070698_1008613131 128
36 3300005518 Ga0070699_100120588 Ga0070699_1001205882 128
37 3300005518 Ga0070699_101340996 Ga0070699_1013409962 128
38 3300005530 Ga0070679_100770552 Ga0070679_1007705522 128
39 3300005535 Ga0070684_100638132 Ga0070684_1006381322 128
40 3300005536 Ga0070697_100013401 Ga0070697_1000134013 128
41 3300005543 Ga0070672_100484134 Ga0070672_1004841342 128
42 3300005544 Ga0070686_100283287 Ga0070686_1002832873 128
43 3300005563 Ga0068855_100135898 Ga0068855_1001358983 128
44 3300005577 Ga0068857_100615561 Ga0068857_1006155612 128
45 3300005616 Ga0068852_100366857 Ga0068852_1003668573 128
46 3300005616 Ga0068852_101571627 Ga0068852_1015716271 128
47 3300005617 Ga0068859_100582235 Ga0068859_1005822353 128
48 3300005617 Ga0068859_100630960 Ga0068859_1006309601 128
49 3300005618 Ga0068864_100862243 Ga0068864_1008622432 128
50 3300005719 Ga0068861_100136121 Ga0068861_1001361213 128
51 3300005840 Ga0068870_10412859 Ga0068870_104128592 128
52 3300005842 Ga0068858_100460795 Ga0068858_1004607952 128
53 3300005844 Ga0068862_100817026 Ga0068862_1008170262 128
54 3300006844 Ga0075428_102347498 Ga0075428_1023474982 128
55 3300006846 Ga0075430_100052005 Ga0075430_1000520054 128
56 3300006852 Ga0075433_10971797 Ga0075433_109717972 128
57 3300006880 Ga0075429_100386760 Ga0075429_1003867602 128
58 3300006880 Ga0075429_100386946 Ga0075429_1003869462 128
59 3300006880 Ga0075429_100556044 Ga0075429_1005560442 128
60 3300006931 Ga0097620_100582261 Ga0097620_1005822613 128
61 3300006931 Ga0097620_100630882 Ga0097620_1006308821 128
62 3300009093 Ga0105240_10032604 Ga0105240_100326043 128
63 3300009093 Ga0105240_10198557 Ga0105240_101985573 128
64 3300009093 Ga0105240_11155137 Ga0105240_111551372 128
65 3300009094 Ga0111539_10004119 Ga0111539_100041199 128
66 3300009094 Ga0111539_10071815 Ga0111539_100718157 128
67 3300009094 Ga0111539_10306644 Ga0111539_103066442 128
68 3300009094 Ga0111539_10392145 Ga0111539_103921452 128
69 3300009094 Ga0111539_11515808 Ga0111539_115158081 128
70 3300009098 Ga0105245_11887951 Ga0105245_118879512 128
71 3300009147 Ga0114129_11681079 Ga0114129_116810792 128
72 3300009174 Ga0105241_10255462 Ga0105241_102554622 128
73 3300009177 Ga0105248_10574748 Ga0105248_105747482 128
74 3300009551 Ga0105238_10010384 Ga0105238_100103849 128
75 3300009553 Ga0105249_10831357 Ga0105249_108313572 128
76 3300009553 Ga0105249_12621561 Ga0105249_126215611 128
77 3300010375 Ga0105239_10078843 Ga0105239_100788433 128
78 3300010375 Ga0105239_10381549 Ga0105239_103815492 128
79 3300013104 Ga0157370_10015306 Ga0157370_100153066 128
80 3300013105 Ga0157369_10008378 Ga0157369_100083783 128
81 3300013296 Ga0157374_11410816 Ga0157374_114108162 128
82 3300013296 Ga0157374_11736178 Ga0157374_117361781 128
83 3300013307 Ga0157372_10559290 Ga0157372_105592903 128
84 3300013308 Ga0157375_10464518 Ga0157375_104645182 128
85 3300014326 Ga0157380_10087206 Ga0157380_100872064 128
86 3300014968 Ga0157379_10568566 Ga0157379_105685662 128
87 3300021388 Ga0213875_10015619 Ga0213875_100156191 128
88 3300025912 Ga0207707_10664729 Ga0207707_106647292 128
89 3300025913 Ga0207695_10079854 Ga0207695_100798544 128
90 3300025917 Ga0207660_10516090 Ga0207660_105160902 128
91 3300025918 Ga0207662_10477736 Ga0207662_104777362 128
92 3300025919 Ga0207657_10001567 Ga0207657_1000156712 128
93 3300025921 Ga0207652_10941231 Ga0207652_109412312 128
94 3300025923 Ga0207681_10669518 Ga0207681_106695182 128
95 3300025923 Ga0207681_10870793 Ga0207681_108707932 128
96 3300025931 Ga0207644_10550836 Ga0207644_105508363 128
97 3300025933 Ga0207706_10099962 Ga0207706_100999624 128
98 3300025940 Ga0207691_10214234 Ga0207691_102142342 128
99 3300025961 Ga0207712_10650388 Ga0207712_106503882 128
100 3300026035 Ga0207703_10045520 Ga0207703_100455202 128
101 3300026075 Ga0207708_10176389 Ga0207708_101763893 128
102 3300026075 Ga0207708_10408928 Ga0207708_104089282 128
103 3300026088 Ga0207641_11555258 Ga0207641_115552581 128
104 3300026089 Ga0207648_10330992 Ga0207648_103309922 128
105 3300026118 Ga0207675_100251325 Ga0207675_1002513252 128
106 3300026142 Ga0207698_10031678 Ga0207698_100316784 128
107 3300027907 Ga0207428_10045534 Ga0207428_100455343 128
108 3300027907 Ga0207428_10124928 Ga0207428_101249282 128
109 3300027907 Ga0207428_10625689 Ga0207428_106256892 128
110 3300028380 Ga0268265_10767259 Ga0268265_107672592 128
111 3300028380 Ga0268265_11315356 Ga0268265_113153562 128
112 3300028666 Ga0265336_10142072 Ga0265336_101420722 128
113 3300028800 Ga0265338_10114554 Ga0265338_101145543 128
114 3300028800 Ga0265338_10228982 Ga0265338_102289823 128
115 3300031238 Ga0265332_10202790 Ga0265332_102027902 128
116 3300031239 Ga0265328_10070268 Ga0265328_100702682 128
117 3300031240 Ga0265320_10002539 Ga0265320_100025394 128
118 3300031241 Ga0265325_10038059 Ga0265325_100380593 128
119 3300031241 Ga0265325_10203859 Ga0265325_102038592 128
120 3300031247 Ga0265340_10110214 Ga0265340_101102142 128
121 3300031249 Ga0265339_10055884 Ga0265339_100558843 128
122 3300031250 Ga0265331_10007746 Ga0265331_100077464 128
123 3300031344 Ga0265316_10563664 Ga0265316_105636642 128
124 3300031548 Ga0307408_101707817 Ga0307408_1017078172 128
125 3300031595 Ga0265313_10153565 Ga0265313_101535652 128
126 3300031711 Ga0265314_10063471 Ga0265314_100634712 128
127 3300031711 Ga0265314_10159307 Ga0265314_101593073 128
128 3300031711 Ga0265314_10458908 Ga0265314_104589082 128
129 3300035086 Ga0373934_0000923 Ga0373934_0000923_2374_2781 128
130 3300035120 Ga0373957_0002948 Ga0373957_0002948_2825_3232 128
131 3300035172 Ga0373955_0002190 Ga0373955_0002190_139_546 128
132 3300035724 Ga0373933_0926603 Ga0373933_0926603_71_457 128
133 3300036401 Ga0373937_0000586 Ga0373937_0000586_24006_24413 128
134 3300037068 Ga0373925_0873790 Ga0373925_0873790_326_718 128
135 3300037312 Ga0395899_0529876 Ga0395899_0529876_330_722 128
136 3300037471 Ga0395905_0664643 Ga0395905_0664643_23_427 128
137 3300037471 Ga0395905_0838908 Ga0395905_0838908_382_774 128
138 3300037853 Ga0436364_1356050 Ga0436364_1356050_4313_4699 128
139 3300046454 Ga0495592_0781941 Ga0495592_0781941_28_435 128
140 3300046455 Ga0495603_0683486 Ga0495603_0683486_167_553 128
141 3300046459 Ga0495629_0824796 Ga0495629_0824796_177_563 128
142 3300046462 Ga0495651_0035424 Ga0495651_0035424_2070_2477 128
143 3300046463 Ga0495653_0948082 Ga0495653_0948082_35_421 128
144 3300046472 Ga0495580_0000494 Ga0495580_0000494_16969_17355 128
145 3300046499 Ga0495594_0270925 Ga0495594_0270925_401_787 128
146 3300046514 Ga0495618_0258493 Ga0495618_0258493_685_1071 128
147 3300046517 Ga0495630_0660653 Ga0495630_0660653_348_734 128
148 3300046543 Ga0495645_0686219 Ga0495645_0686219_97_483 128
149 3300046559 Ga0495667_0269418 Ga0495667_0269418_78_464 128
150 3300046678 Ga0495599_0253023 Ga0495599_0253023_297_683 128
151 3300046681 Ga0495647_0310978 Ga0495647_0310978_211_597 128
152 3300046683 Ga0495658_0208663 Ga0495658_0208663_449_835 128
153 3300047319 Ga0495674_0015069 Ga0495674_0015069_1313_1699 128
154 3300047322 Ga0495680_0195359 Ga0495680_0195359_128_535 128
155 3300047444 Ga0495675_0055667 Ga0495675_0055667_1487_1873 128
156 3300047471 Ga0495684_0076063 Ga0495684_0076063_1451_1837 128
157 3300050508 nmdc:mga09592_1049052_c1 nmdc:mga09592_1049052_c1_34_423 128
158 3300050508 nmdc:mga09592_309957_c1 nmdc:mga09592_309957_c1_451_837 128
159 3300050508 nmdc:mga09592_432054_c1 nmdc:mga09592_432054_c1_332_718 128
160 3300050509 nmdc:mga0qj67_86281_c1 nmdc:mga0qj67_86281_c1_265_651 128
161 3300050511 nmdc:mga08y16_1417083_c1 nmdc:mga08y16_1417083_c1_98_484 128
162 3300050511 nmdc:mga08y16_181737_c1 nmdc:mga08y16_181737_c1_822_1208 128
163 3300050511 nmdc:mga08y16_28933_c1 nmdc:mga08y16_28933_c1_4544_4930 128
164 3300050511 nmdc:mga08y16_842597_c1 nmdc:mga08y16_842597_c1_73_459 128
165 3300053085 Ga0495619_0310497 Ga0495619_0310497_184_570 128
166 3300053090 Ga0500646_0200682 Ga0500646_0200682_21_407 128
167 3300060353 Ga0501082_0944633 Ga0501082_0944633_300_704 128

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

1

132

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xgr-assembly1.cif.gz_A crystal structure of addiction module from mycobacterial species 0.9355 1 128
4xgq-assembly2.cif.gz_G crystal structure of addiction module from mycobacterial species 0.907 1 128
4xgq-assembly2.cif.gz_G crystal structure of addiction module from mycobacterial species 0.9006 1 128
5x3t-assembly1.cif.gz_H vapbc from mycobacterium tuberculosis 0.8181 1 116
5wz4-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis vapc20 (rv2549c), sarcin-ricin loop cleaving toxin 0.7937 2 128
ID Description Score Start End Superfamily
af_P9WF81_1_130_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9512 1 127 3.40.50.1010
af_P9WF81_1_130_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.937 1 127 3.40.50.1010
af_P9WF57_1_130_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9309 1 127 3.40.50.1010
af_P9WF57_1_130_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9171 1 127 3.40.50.1010
af_P9WF65_1_129_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9146 1 128 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A7W0X7R9-F1-model_v4 Type II toxin-antitoxin system VapC family toxin 0.9962 67 128 GO:0004518
AF-A0A840X456-F1-model_v4 Uncharacterized protein with PIN domain 0.9847 58 128 GO:0004518
AF-A0A521LQR7-F1-model_v4 PIN domain-containing protein 0.9841 69 128
AF-A0A1F2S813-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.984 1 128 GO:0000287
GO:0004540
GO:0090729
AF-A0A7S8IKM2-F1-model_v4 PIN domain-containing protein 0.9838 59 128

Feature Viewer

pLDDT pTM Quality
96.87 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map