F249485

General Info

Members Datasets Scaffolds Average Seq Length
166 139 159 336

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8003151029|8003157006
Length 389
Sequence GGRLSDILVLNLMQGTFLCVAATYGGAISTNFVNQFYQSFIMLKSYNITLLLQAMLVLAACNETPATGGDHTAYFTPVDSGVQTGGVKIIPISTSKGTFNIWTKRTGNNPKIKVLLITGGPGATHEYAEAFDSFFPQEEIEYIYYDQLGCGNSDNPKDTALYDLNRSVEEIEQVRKALNLTNENFYIWGHSWGGVVAMEYALKYQDNLKALIISDMMASAKDYNDYADNVLAKQMDPKILDSIRAIEAKNDFDNPKYMELLMPNFYAKHICRLPEFPDPVLRAMGKINESFYRTMQGPSEFGLSGKLTNWDVKGKLPQIKVPTLSIGAKYDTMDPEHMKWIAGQVQNGSYLYCPNGSHLCMYDDQAVYMKGLVKFILAVNNGEKKVALN

Samples

Sample ID Description Type Environment
1 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
2 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
3 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
4 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
44 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
53 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
54 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
55 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
73 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
75 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
76 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
77 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
80 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
83 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
89 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
90 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
91 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
92 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
93 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
94 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
95 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
96 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
97 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
98 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
99 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
100 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
101 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
102 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
103 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
104 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
105 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
106 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
107 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
108 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
109 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
110 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
111 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
112 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
113 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
114 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
115 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
116 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
117 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
118 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
119 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
120 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
121 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
122 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
123 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
124 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
125 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
126 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
127 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
128 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
129 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
130 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
131 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
134 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
135 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
136 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
137 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
138 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
139 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.78
Metatranscriptomes 0
Isolates 4.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.64
Nodule 1.81
Rhizoplane 0.6
Rhizosphere 76.51
Stem 0
Stem Tuber 0
Unclassified 11.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001518 3300001979 Bacteria 10666
2 JGI24739J22299_10044009 3300001989 Unclassified 1472
3 JGI25154J39366_1000031 3300002738 Bacteria 190814
4 JGI25406J46586_10000216 3300003203 Bacteria 25386
5 JGI25153J46596_10008628 3300003215 Unclassified 4850
6 JGI25153J46596_10010152 3300003215 Bacteria 4286
7 rootL2_10262583 3300003322 Bacteria 2496
8 Ga0055526_1017812 3300003771 Bacteria 2689
9 Ga0055528_1000738 3300003790 Bacteria 22801
10 Ga0065165_1000017 3300005262 Bacteria 278286
11 Ga0065714_10006600 3300005288 Bacteria 3523
12 Ga0065714_10103531 3300005288 Bacteria 1601
13 Ga0070690_100001626 3300005330 Bacteria 11811
14 Ga0070682_100000060 3300005337 Bacteria 105136
15 Ga0070668_100027189 3300005347 Bacteria 4342
16 Ga0070669_100048439 3300005353 Bacteria 3102
17 Ga0070675_100096033 3300005354 Bacteria 2490
18 Ga0070688_100043339 3300005365 Bacteria 2772
19 Ga0070688_100175363 3300005365 Bacteria 1483
20 Ga0070709_10078804 3300005434 Bacteria 2144
21 Ga0070714_100014672 3300005435 Bacteria 6295
22 Ga0070713_100015395 3300005436 Bacteria 5715
23 Ga0070701_10030254 3300005438 Bacteria 2677
24 Ga0070701_10207362 3300005438 Bacteria 1162
25 Ga0070705_100128336 3300005440 Bacteria 1650
26 Ga0070662_100120382 3300005457 Bacteria 2011
27 Ga0070698_100056411 3300005471 Bacteria 3981
28 Ga0070698_100254483 3300005471 Bacteria 1688
29 Ga0070699_100000012 3300005518 Bacteria 246521
30 Ga0070686_100102404 3300005544 Unclassified 1937
31 Ga0070665_100068602 3300005548 Bacteria 3555
32 Ga0070664_100150425 3300005564 Bacteria 2055
33 Ga0068859_100003639 3300005617 Bacteria 15707
34 Ga0068859_100105379 3300005617 Bacteria 2879
35 Ga0068851_10000066 3300005834 Bacteria 58581
36 Ga0068851_10005394 3300005834 Bacteria 5800
37 Ga0068860_100452995 3300005843 Bacteria 1276
38 Ga0081455_10070176 3300005937 Bacteria 2910
39 Ga0081539_10000047 3300005985 Bacteria 275235
40 Ga0070717_10033012 3300006028 Bacteria 4174
41 Ga0070712_100186701 3300006175 Bacteria 1619
42 Ga0075433_10003470 3300006852 Bacteria 12173
43 Ga0075433_10073359 3300006852 Bacteria 3010
44 Ga0075434_100178811 3300006871 Bacteria 2141
45 Ga0075429_100150864 3300006880 Bacteria 2035
46 Ga0097620_100003639 3300006931 Bacteria 15707
47 Ga0097620_100105380 3300006931 Bacteria 2879
48 Ga0099824_1009673 3300006942 Bacteria 11735
49 Ga0099826_10001865 3300006948 Bacteria 13137
50 Ga0111539_10122107 3300009094 Bacteria 3053
51 Ga0105245_10679357 3300009098 Bacteria 1062
52 Ga0157371_10004684 3300013102 Bacteria 11824
53 Ga0157369_10187184 3300013105 Bacteria 2177
54 Ga0157374_10350760 3300013296 Unclassified 1466
55 Ga0182006_1009363 3300015261 Bacteria 4392
56 Ga0182006_1039332 3300015261 Bacteria 1867
57 Ga0163161_10000070 3300017792 Bacteria 103561
58 Ga0163161_10000576 3300017792 Bacteria 29505
59 Ga0213872_10001110 3300021361 Bacteria 18394
60 Ga0209646_1000009 3300025246 Bacteria 652154
61 Ga0209026_1000403 3300025250 Bacteria 38393
62 Ga0209673_1000083 3300025273 Bacteria 216509
63 Ga0209564_1001902 3300025295 Bacteria 18709
64 Ga0209564_1007541 3300025295 Bacteria 5603
65 Ga0209758_1001318 3300025297 Bacteria 30178
66 Ga0209758_1004241 3300025297 Bacteria 12130
67 Ga0209050_1000273 3300025298 Bacteria 110451
68 Ga0207426_1000339 3300025302 Bacteria 87978
69 Ga0207426_1001089 3300025302 Bacteria 25231
70 Ga0209257_1003330 3300025304 Bacteria 13906
71 Ga0207656_10005151 3300025321 Bacteria 4596
72 Ga0207656_10013780 3300025321 Bacteria 3099
73 Ga0207699_10051685 3300025906 Bacteria 2429
74 Ga0207684_10171275 3300025910 Bacteria 1872
75 Ga0207681_10056619 3300025923 Bacteria 2675
76 Ga0207700_10000183 3300025928 Bacteria 37732
77 Ga0207664_10003449 3300025929 Bacteria 10541
78 Ga0207665_10008903 3300025939 Bacteria 6592
79 Ga0207689_10112195 3300025942 Bacteria 2241
80 Ga0207679_10174914 3300025945 Bacteria 1771
81 Ga0207712_10109675 3300025961 Bacteria 2068
82 Ga0207675_100006556 3300026118 Bacteria 11014
83 Ga0209489_112195 3300027361 Bacteria 8043
84 Ga0268264_10425399 3300028381 Bacteria 1282
85 Ga0307517_10006167 3300028786 Bacteria 17857
86 Ga0307515_10000794 3300028794 Bacteria 72827
87 Ga0307515_10108549 3300028794 Bacteria 3269
88 Ga0265332_10006680 3300031238 Bacteria 5224
89 Ga0307509_10000070 3300031507 Bacteria 141228
90 Ga0307509_10033710 3300031507 Bacteria 5634
91 Ga0307408_100062479 3300031548 Bacteria 2722
92 Ga0307508_10010922 3300031616 Bacteria 8306
93 Ga0307514_10001361 3300031649 Bacteria 30951
94 Ga0307405_10020007 3300031731 Bacteria 3731
95 Ga0307413_10003804 3300031824 Bacteria 6437
96 Ga0307413_10252846 3300031824 Bacteria 1308
97 Ga0307407_10000397 3300031903 Bacteria 13211
98 Ga0307407_10049959 3300031903 Bacteria 2390
99 Ga0307412_10008852 3300031911 Bacteria 5764
100 Ga0307409_100007252 3300031995 Bacteria 6612
101 Ga0307416_100043829 3300032002 Bacteria 3507
102 Ga0307415_100081138 3300032126 Bacteria 2316
103 Ga0373949_0000292 3300035090 Bacteria 18220
104 Ga0373956_0149983 3300035119 Bacteria 1097
105 Ga0436361_0302074 3300039447 Bacteria 152020
106 Ga0436363_1689440 3300039450 Bacteria 11337
107 Ga0495609_0003331 3300046538 Bacteria 9261
108 Ga0495633_0000044 3300046558 Bacteria 171185
109 Ga0495668_0000050 3300046616 Bacteria 214716
110 Ga0495625_0003717 3300046660 Bacteria 14877
111 Ga0495625_0167604 3300046660 Bacteria 1468
112 Ga0496104_0120889 3300048907 Bacteria 2515
113 Ga0496121_0000043 3300048924 Bacteria 341882
114 Ga0496125_0000012 3300048928 Bacteria 651142
115 Ga0501292_006607 3300049515 Bacteria 1653
116 Ga0501201_001539 3300049651 Bacteria 2149
117 Ga0501207_000349 3300049654 Bacteria 4989
118 Ga0501208_001236 3300049655 Bacteria 2371
119 Ga0501211_007871 3300049658 Bacteria 1041
120 Ga0501217_001959 3300049661 Bacteria 3960
121 Ga0501217_003297 3300049661 Bacteria 3253
122 Ga0501224_002806 3300049664 Bacteria 2401
123 Ga0501227_002588 3300049665 Bacteria 3974
124 Ga0501228_000538 3300049666 Bacteria 2457
125 Ga0501230_011759 3300049667 Bacteria 1392
126 Ga0501233_000355 3300049668 Bacteria 7160
127 Ga0501235_001578 3300049669 Bacteria 4884
128 Ga0501240_003227 3300049673 Bacteria 1800
129 Ga0501240_012326 3300049673 Bacteria 1168
130 Ga0501242_002234 3300049674 Bacteria 2023
131 Ga0501243_002864 3300049675 Bacteria 2543
132 Ga0501243_003275 3300049675 Bacteria 2392
133 Ga0501248_004958 3300049678 Bacteria 1029
134 Ga0501249_004222 3300049679 Bacteria 2915
135 Ga0501257_012125 3300049686 Bacteria 1970
136 Ga0501258_004511 3300049687 Bacteria 1319
137 Ga0501259_000815 3300049688 Bacteria 5118
138 Ga0501261_000796 3300049690 Bacteria 3934
139 Ga0501221_000083 3300049704 Bacteria 10820
140 Ga0501225_0002327 3300049705 Bacteria 5861
141 Ga0501225_0056891 3300049705 Bacteria 1095
142 Ga0501234_000805 3300049707 Bacteria 4919
143 Ga0501245_001598 3300049708 Bacteria 2949
144 Ga0501081_0237596 3300049743 Bacteria 1328
145 Ga0501263_000876 3300049760 Bacteria 2585
146 Ga0501266_001683 3300049763 Bacteria 2812
147 Ga0501268_000157 3300049765 Bacteria 6188
148 Ga0501271_001262 3300049768 Bacteria 2151
149 Ga0501274_001558 3300049771 Bacteria 1758
150 Ga0501212_002395 3300049851 Bacteria 2258
151 nmdc:mga09592_122078_c1 3300050508 Bacteria 2238
152 nmdc:mga08y16_75509_c1 3300050511 Bacteria 3513
153 nmdc:mga0n895_139256_c1 3300050512 Bacteria 2454
154 nmdc:mga0n895_72664_c1 3300050512 Bacteria 3413
155 nmdc:mga0rr50_50097_c1 3300050513 Bacteria 3093
156 nmdc:mga0a205_19576_c1 3300050515 Bacteria 6384
157 nmdc:mga0a205_55243_c1 3300050515 Bacteria 3836
158 Ga0500644_0001292 3300053088 Bacteria 6811
159 Ga0500597_010082 3300053120 Unclassified 3355

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009098 Ga0105245_10679357 Ga0105245_106793571 294
2 3300049768 Ga0501271_001262 Ga0501271_001262_324_1214 294
3 3300031548 Ga0307408_100062479 Ga0307408_1000624793 303
4 3300031731 Ga0307405_10020007 Ga0307405_100200073 303
5 3300031824 Ga0307413_10252846 Ga0307413_102528462 303
6 3300031903 Ga0307407_10049959 Ga0307407_100499593 303
7 3300031911 Ga0307412_10008852 Ga0307412_100088522 303
8 3300031995 Ga0307409_100007252 Ga0307409_1000072522 303
9 3300032002 Ga0307416_100043829 Ga0307416_1000438293 303
10 3300032126 Ga0307415_100081138 Ga0307415_1000811382 303
11 3300049515 Ga0501292_006607 Ga0501292_006607_105_1022 303
12 3300049651 Ga0501201_001539 Ga0501201_001539_1087_2004 303
13 3300049654 Ga0501207_000349 Ga0501207_000349_3682_4599 303
14 3300049655 Ga0501208_001236 Ga0501208_001236_383_1300 303
15 3300049658 Ga0501211_007871 Ga0501211_007871_43_960 303
16 3300049661 Ga0501217_001959 Ga0501217_001959_1850_2767 303
17 3300049664 Ga0501224_002806 Ga0501224_002806_1401_2318 303
18 3300049665 Ga0501227_002588 Ga0501227_002588_1150_2067 303
19 3300049666 Ga0501228_000538 Ga0501228_000538_305_1222 303
20 3300049667 Ga0501230_011759 Ga0501230_011759_145_1062 303
21 3300049668 Ga0501233_000355 Ga0501233_000355_5354_6271 303
22 3300049669 Ga0501235_001578 Ga0501235_001578_1206_2123 303
23 3300049673 Ga0501240_003227 Ga0501240_003227_848_1765 303
24 3300049674 Ga0501242_002234 Ga0501242_002234_928_1845 303
25 3300049675 Ga0501243_003275 Ga0501243_003275_73_990 303
26 3300049678 Ga0501248_004958 Ga0501248_004958_25_942 303
27 3300049679 Ga0501249_004222 Ga0501249_004222_753_1670 303
28 3300049686 Ga0501257_012125 Ga0501257_012125_62_979 303
29 3300049687 Ga0501258_004511 Ga0501258_004511_357_1274 303
30 3300049688 Ga0501259_000815 Ga0501259_000815_1008_1925 303
31 3300049690 Ga0501261_000796 Ga0501261_000796_556_1473 303
32 3300049704 Ga0501221_000083 Ga0501221_000083_966_1883 303
33 3300049705 Ga0501225_0002327 Ga0501225_0002327_65_982 303
34 3300049707 Ga0501234_000805 Ga0501234_000805_823_1740 303
35 3300049708 Ga0501245_001598 Ga0501245_001598_1320_2237 303
36 3300049760 Ga0501263_000876 Ga0501263_000876_539_1456 303
37 3300049763 Ga0501266_001683 Ga0501266_001683_1617_2534 303
38 3300049765 Ga0501268_000157 Ga0501268_000157_152_1069 303
39 3300049771 Ga0501274_001558 Ga0501274_001558_291_1208 303
40 3300049851 Ga0501212_002395 Ga0501212_002395_558_1475 303
41 3300025910 Ga0207684_10171275 Ga0207684_101712752 314
42 3300005471 Ga0070698_100056411 Ga0070698_1000564115 317
43 3300006175 Ga0070712_100186701 Ga0070712_1001867012 318
44 3300025928 Ga0207700_10000183 Ga0207700_1000018329 318
45 3300049675 Ga0501243_002864 Ga0501243_002864_1542_2528 323
46 3300005544 Ga0070686_100102404 Ga0070686_1001024041 327
47 3300013102 Ga0157371_10004684 Ga0157371_100046846 327
48 3300013105 Ga0157369_10187184 Ga0157369_101871842 327
49 3300028794 Ga0307515_10108549 Ga0307515_101085493 327
50 3300017792 Ga0163161_10000576 Ga0163161_1000057618 328
51 3300005330 Ga0070690_100001626 Ga0070690_1000016269 329
52 3300025961 Ga0207712_10109675 Ga0207712_101096752 329
53 3300053088 Ga0500644_0001292 Ga0500644_0001292_5732_6724 329
54 3300053120 Ga0500597_010082 Ga0500597_010082_356_1423 329
55 3300005843 Ga0068860_100452995 Ga0068860_1004529951 330
56 3300028381 Ga0268264_10425399 Ga0268264_104253991 330
57 3300005337 Ga0070682_100000060 Ga0070682_10000006013 331
58 3300006880 Ga0075429_100150864 Ga0075429_1001508641 331
59 3300015261 Ga0182006_1009363 Ga0182006_10093632 331
60 3300015261 Ga0182006_1039332 Ga0182006_10393321 331
61 3300035119 Ga0373956_0149983 Ga0373956_0149983_50_1081 331
62 3300039450 Ga0436363_1689440 Ga0436363_1689440_5356_6402 331
63 3300050508 nmdc:mga09592_122078_c1 nmdc:mga09592_122078_c1_1073_2125 331
64 3300005548 Ga0070665_100068602 Ga0070665_1000686024 333
65 3300006852 Ga0075433_10073359 Ga0075433_100733594 333
66 3300050512 nmdc:mga0n895_139256_c1 nmdc:mga0n895_139256_c1_1175_2188 333
67 3300050515 nmdc:mga0a205_19576_c1 nmdc:mga0a205_19576_c1_2578_3618 333
68 3300031649 Ga0307514_10001361 Ga0307514_100013616 334
69 3300013296 Ga0157374_10350760 Ga0157374_103507601 335
70 3300005937 Ga0081455_10070176 Ga0081455_100701761 336
71 3300049661 Ga0501217_003297 Ga0501217_003297_312_1337 336
72 3300049673 Ga0501240_012326 Ga0501240_012326_52_1077 336
73 3300049705 Ga0501225_0056891 Ga0501225_0056891_21_1046 336
74 3300005834 Ga0068851_10005394 Ga0068851_100053944 337
75 3300025321 Ga0207656_10013780 Ga0207656_100137803 337
76 3300048924 Ga0496121_0000043 Ga0496121_0000043_270945_271967 337
77 iso_pu_bacteria 2739367857 2740001579 337
78 iso_pu_bacteria 2739367858 2740006395 337
79 3300031238 Ga0265332_10006680 Ga0265332_100066804 339
80 3300031507 Ga0307509_10000070 Ga0307509_1000007021 339
81 3300031616 Ga0307508_10010922 Ga0307508_100109224 339
82 3300005434 Ga0070709_10078804 Ga0070709_100788042 340
83 3300005435 Ga0070714_100014672 Ga0070714_1000146722 340
84 3300005436 Ga0070713_100015395 Ga0070713_1000153956 340
85 3300005471 Ga0070698_100254483 Ga0070698_1002544832 340
86 3300005518 Ga0070699_100000012 Ga0070699_100000012181 340
87 3300005617 Ga0068859_100105379 Ga0068859_1001053793 340
88 3300006028 Ga0070717_10033012 Ga0070717_100330123 340
89 3300006931 Ga0097620_100105380 Ga0097620_1001053803 340
90 3300021361 Ga0213872_10001110 Ga0213872_1000111012 340
91 3300025906 Ga0207699_10051685 Ga0207699_100516852 340
92 3300025929 Ga0207664_10003449 Ga0207664_100034495 340
93 3300026118 Ga0207675_100006556 Ga0207675_1000065564 340
94 3300035090 Ga0373949_0000292 Ga0373949_0000292_16704_17732 340
95 3300039447 Ga0436361_0302074 Ga0436361_0302074_143716_144753 340
96 3300048907 Ga0496104_0120889 Ga0496104_0120889_151_1185 340
97 3300049743 Ga0501081_0237596 Ga0501081_0237596_248_1288 340
98 iso_pu_bacteria 8055419101 8055422438 340
99 iso_pu_bacteria 8055419101 8055423790 340
100 3300005347 Ga0070668_100027189 Ga0070668_1000271892 341
101 3300005353 Ga0070669_100048439 Ga0070669_1000484392 341
102 3300005354 Ga0070675_100096033 Ga0070675_1000960332 341
103 3300005457 Ga0070662_100120382 Ga0070662_1001203822 341
104 3300006871 Ga0075434_100178811 Ga0075434_1001788112 341
105 3300025923 Ga0207681_10056619 Ga0207681_100566192 341
106 3300025939 Ga0207665_10008903 Ga0207665_100089034 341
107 3300003322 rootL2_10262583 rootL2_102625831 342
108 3300001989 JGI24739J22299_10044009 JGI24739J22299_100440092 343
109 3300003203 JGI25406J46586_10000216 JGI25406J46586_1000021617 343
110 3300003215 JGI25153J46596_10008628 JGI25153J46596_100086282 343
111 3300003771 Ga0055526_1017812 Ga0055526_10178121 343
112 3300003790 Ga0055528_1000738 Ga0055528_10007389 343
113 3300005262 Ga0065165_1000017 Ga0065165_1000017109 343
114 3300005288 Ga0065714_10103531 Ga0065714_101035312 343
115 3300005365 Ga0070688_100175363 Ga0070688_1001753632 343
116 3300005438 Ga0070701_10207362 Ga0070701_102073621 343
117 3300005440 Ga0070705_100128336 Ga0070705_1001283362 343
118 3300005564 Ga0070664_100150425 Ga0070664_1001504252 343
119 3300005617 Ga0068859_100003639 Ga0068859_10000363910 343
120 3300005985 Ga0081539_10000047 Ga0081539_1000004738 343
121 3300006852 Ga0075433_10003470 Ga0075433_1000347010 343
122 3300006931 Ga0097620_100003639 Ga0097620_10000363910 343
123 3300009094 Ga0111539_10122107 Ga0111539_101221072 343
124 3300025273 Ga0209673_1000083 Ga0209673_1000083119 343
125 3300025295 Ga0209564_1001902 Ga0209564_100190218 343
126 3300025295 Ga0209564_1007541 Ga0209564_10075414 343
127 3300025297 Ga0209758_1001318 Ga0209758_100131823 343
128 3300025297 Ga0209758_1004241 Ga0209758_10042413 343
129 3300025298 Ga0209050_1000273 Ga0209050_100027333 343
130 3300025302 Ga0207426_1001089 Ga0207426_100108916 343
131 3300025304 Ga0209257_1003330 Ga0209257_100333015 343
132 3300025945 Ga0207679_10174914 Ga0207679_101749142 343
133 3300031824 Ga0307413_10003804 Ga0307413_100038046 343
134 3300031903 Ga0307407_10000397 Ga0307407_100003974 343
135 3300050511 nmdc:mga08y16_75509_c1 nmdc:mga08y16_75509_c1_1041_2084 343
136 3300050512 nmdc:mga0n895_72664_c1 nmdc:mga0n895_72664_c1_1096_2139 343
137 3300050513 nmdc:mga0rr50_50097_c1 nmdc:mga0rr50_50097_c1_563_1606 343
138 3300050515 nmdc:mga0a205_55243_c1 nmdc:mga0a205_55243_c1_727_1770 343
139 3300006942 Ga0099824_1009673 Ga0099824_100967312 344
140 3300006948 Ga0099826_10001865 Ga0099826_100018658 344
141 3300017792 Ga0163161_10000070 Ga0163161_1000007055 344
142 3300027361 Ga0209489_112195 Ga0209489_1121956 344
143 3300046616 Ga0495668_0000050 Ga0495668_0000050_30381_31508 344
144 3300048928 Ga0496125_0000012 Ga0496125_0000012_547601_548653 344
145 iso_pu_bacteria 2929921140 2929924543 344
146 3300005834 Ga0068851_10000066 Ga0068851_1000006640 345
147 3300025321 Ga0207656_10005151 Ga0207656_100051513 345
148 3300025942 Ga0207689_10112195 Ga0207689_101121951 345
149 3300005288 Ga0065714_10006600 Ga0065714_100066001 346
150 3300005365 Ga0070688_100043339 Ga0070688_1000433392 346
151 3300005438 Ga0070701_10030254 Ga0070701_100302542 346
152 3300031507 Ga0307509_10033710 Ga0307509_100337102 346
153 3300046538 Ga0495609_0003331 Ga0495609_0003331_4738_5796 346
154 3300028786 Ga0307517_10006167 Ga0307517_1000616714 347
155 3300028794 Ga0307515_10000794 Ga0307515_1000079412 347
156 3300046558 Ga0495633_0000044 Ga0495633_0000044_39890_40951 347
157 3300046660 Ga0495625_0003717 Ga0495625_0003717_3651_4712 347
158 3300046660 Ga0495625_0167604 Ga0495625_0167604_213_1277 347
159 iso_pu_bacteria 2977232053 2977233493 347
160 3300001979 JGI24740J21852_10001518 JGI24740J21852_100015185 348
161 3300002738 JGI25154J39366_1000031 JGI25154J39366_100003167 348
162 3300003215 JGI25153J46596_10010152 JGI25153J46596_100101522 348
163 3300025246 Ga0209646_1000009 Ga0209646_1000009338 348
164 3300025250 Ga0209026_1000403 Ga0209026_100040320 348
165 3300025302 Ga0207426_1000339 Ga0207426_100033976 348
166 iso_pu_bacteria 8003151029 8003157006 348

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12146

Hydrolase_4

Serine aminopeptidase, S33

108

264

0.83

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

113

365

0.81

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

114

369

0.53

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wmr-assembly3.cif.gz_C crystal structure of vinj 0.9225 47 338
7a6g-assembly1.cif.gz_A structural characterization of l-proline amide hydrolase from pseudomonas syringae 0.9158 46 337
1xrp-assembly1.cif.gz_A crystal structure of active site f1-mutant e213q soaked with peptide pro-leu-gly-gly 0.9093 46 337
3wmr-assembly3.cif.gz_C crystal structure of vinj 0.9076 47 338
1xqx-assembly1.cif.gz_A crystal structure of f1-mutant s105a complex with pck 0.9075 46 337
ID Description Score Start End Superfamily
af_I6Y8X0_7_285_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9485 60 337 3.40.50.1820
af_I6Y8X0_7_285_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9222 60 337 3.40.50.1820
3wmrB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9175 47 338 3.40.50.1820
1xrpA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9093 46 337 3.40.50.1820
3wmrB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9027 47 338 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A519SZ51-F1-model_v4 Alpha/beta fold hydrolase 0.9929 60 341 GO:0006508
GO:0008233
GO:0016020
AF-A0A519RR88-F1-model_v4 Alpha/beta fold hydrolase 0.9918 29 341 GO:0006508
GO:0008233
GO:0016020
AF-A0A350BVS3-F1-model_v4 Proline iminopeptidase 0.9918 49 342 GO:0004177
GO:0006508
GO:0016020
AF-A0A524BIX1-F1-model_v4 Proline iminopeptidase 0.9901 46 337 GO:0004177
GO:0006508
AF-A0A848QFN0-F1-model_v4 deleted 0.9888 33 340

Feature Viewer

pLDDT pTM Quality
92.03 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map