F249485
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 166 | 139 | 159 | 336 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|8003151029|8003157006 |
| Length | 389 |
| Sequence | GGRLSDILVLNLMQGTFLCVAATYGGAISTNFVNQFYQSFIMLKSYNITLLLQAMLVLAACNETPATGGDHTAYFTPVDSGVQTGGVKIIPISTSKGTFNIWTKRTGNNPKIKVLLITGGPGATHEYAEAFDSFFPQEEIEYIYYDQLGCGNSDNPKDTALYDLNRSVEEIEQVRKALNLTNENFYIWGHSWGGVVAMEYALKYQDNLKALIISDMMASAKDYNDYADNVLAKQMDPKILDSIRAIEAKNDFDNPKYMELLMPNFYAKHICRLPEFPDPVLRAMGKINESFYRTMQGPSEFGLSGKLTNWDVKGKLPQIKVPTLSIGAKYDTMDPEHMKWIAGQVQNGSYLYCPNGSHLCMYDDQAVYMKGLVKFILAVNNGEKKVALN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2739367857 | Flavobacterium sp. GV029 | Isolate | Unclassified |
| 2 | 2739367858 | Flavobacterium sp. GV028 | Isolate | Unclassified |
| 3 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 4 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 14 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 33 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 34 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 35 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 36 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 37 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 40 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 41 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 42 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 44 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 45 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 51 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 53 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 54 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 55 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 56 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 57 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 73 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 75 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 76 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 77 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 78 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 79 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 80 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 81 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 82 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 83 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 84 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 85 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 86 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 87 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 88 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 89 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 90 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 91 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 92 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 97 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 98 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 99 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 100 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 101 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 102 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 103 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 104 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 105 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 106 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 107 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 108 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 109 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 110 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 111 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 112 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 113 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 114 | 3300049678 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought | Metagenome | Rhizosphere |
| 115 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 116 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 117 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 118 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 119 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 120 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 121 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 122 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 123 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 124 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 125 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 126 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 127 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 128 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 129 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 130 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 131 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 132 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 133 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 134 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 135 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 136 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 137 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 138 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
| 139 | 8055419101 | Flavobacterium tyrosinilyticum KCTC 42726 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.78 |
| Metatranscriptomes | 0 |
| Isolates | 4.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.64 |
| Nodule | 1.81 |
| Rhizoplane | 0.6 |
| Rhizosphere | 76.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10001518 | 3300001979 | Bacteria | 10666 |
| 2 | JGI24739J22299_10044009 | 3300001989 | Unclassified | 1472 |
| 3 | JGI25154J39366_1000031 | 3300002738 | Bacteria | 190814 |
| 4 | JGI25406J46586_10000216 | 3300003203 | Bacteria | 25386 |
| 5 | JGI25153J46596_10008628 | 3300003215 | Unclassified | 4850 |
| 6 | JGI25153J46596_10010152 | 3300003215 | Bacteria | 4286 |
| 7 | rootL2_10262583 | 3300003322 | Bacteria | 2496 |
| 8 | Ga0055526_1017812 | 3300003771 | Bacteria | 2689 |
| 9 | Ga0055528_1000738 | 3300003790 | Bacteria | 22801 |
| 10 | Ga0065165_1000017 | 3300005262 | Bacteria | 278286 |
| 11 | Ga0065714_10006600 | 3300005288 | Bacteria | 3523 |
| 12 | Ga0065714_10103531 | 3300005288 | Bacteria | 1601 |
| 13 | Ga0070690_100001626 | 3300005330 | Bacteria | 11811 |
| 14 | Ga0070682_100000060 | 3300005337 | Bacteria | 105136 |
| 15 | Ga0070668_100027189 | 3300005347 | Bacteria | 4342 |
| 16 | Ga0070669_100048439 | 3300005353 | Bacteria | 3102 |
| 17 | Ga0070675_100096033 | 3300005354 | Bacteria | 2490 |
| 18 | Ga0070688_100043339 | 3300005365 | Bacteria | 2772 |
| 19 | Ga0070688_100175363 | 3300005365 | Bacteria | 1483 |
| 20 | Ga0070709_10078804 | 3300005434 | Bacteria | 2144 |
| 21 | Ga0070714_100014672 | 3300005435 | Bacteria | 6295 |
| 22 | Ga0070713_100015395 | 3300005436 | Bacteria | 5715 |
| 23 | Ga0070701_10030254 | 3300005438 | Bacteria | 2677 |
| 24 | Ga0070701_10207362 | 3300005438 | Bacteria | 1162 |
| 25 | Ga0070705_100128336 | 3300005440 | Bacteria | 1650 |
| 26 | Ga0070662_100120382 | 3300005457 | Bacteria | 2011 |
| 27 | Ga0070698_100056411 | 3300005471 | Bacteria | 3981 |
| 28 | Ga0070698_100254483 | 3300005471 | Bacteria | 1688 |
| 29 | Ga0070699_100000012 | 3300005518 | Bacteria | 246521 |
| 30 | Ga0070686_100102404 | 3300005544 | Unclassified | 1937 |
| 31 | Ga0070665_100068602 | 3300005548 | Bacteria | 3555 |
| 32 | Ga0070664_100150425 | 3300005564 | Bacteria | 2055 |
| 33 | Ga0068859_100003639 | 3300005617 | Bacteria | 15707 |
| 34 | Ga0068859_100105379 | 3300005617 | Bacteria | 2879 |
| 35 | Ga0068851_10000066 | 3300005834 | Bacteria | 58581 |
| 36 | Ga0068851_10005394 | 3300005834 | Bacteria | 5800 |
| 37 | Ga0068860_100452995 | 3300005843 | Bacteria | 1276 |
| 38 | Ga0081455_10070176 | 3300005937 | Bacteria | 2910 |
| 39 | Ga0081539_10000047 | 3300005985 | Bacteria | 275235 |
| 40 | Ga0070717_10033012 | 3300006028 | Bacteria | 4174 |
| 41 | Ga0070712_100186701 | 3300006175 | Bacteria | 1619 |
| 42 | Ga0075433_10003470 | 3300006852 | Bacteria | 12173 |
| 43 | Ga0075433_10073359 | 3300006852 | Bacteria | 3010 |
| 44 | Ga0075434_100178811 | 3300006871 | Bacteria | 2141 |
| 45 | Ga0075429_100150864 | 3300006880 | Bacteria | 2035 |
| 46 | Ga0097620_100003639 | 3300006931 | Bacteria | 15707 |
| 47 | Ga0097620_100105380 | 3300006931 | Bacteria | 2879 |
| 48 | Ga0099824_1009673 | 3300006942 | Bacteria | 11735 |
| 49 | Ga0099826_10001865 | 3300006948 | Bacteria | 13137 |
| 50 | Ga0111539_10122107 | 3300009094 | Bacteria | 3053 |
| 51 | Ga0105245_10679357 | 3300009098 | Bacteria | 1062 |
| 52 | Ga0157371_10004684 | 3300013102 | Bacteria | 11824 |
| 53 | Ga0157369_10187184 | 3300013105 | Bacteria | 2177 |
| 54 | Ga0157374_10350760 | 3300013296 | Unclassified | 1466 |
| 55 | Ga0182006_1009363 | 3300015261 | Bacteria | 4392 |
| 56 | Ga0182006_1039332 | 3300015261 | Bacteria | 1867 |
| 57 | Ga0163161_10000070 | 3300017792 | Bacteria | 103561 |
| 58 | Ga0163161_10000576 | 3300017792 | Bacteria | 29505 |
| 59 | Ga0213872_10001110 | 3300021361 | Bacteria | 18394 |
| 60 | Ga0209646_1000009 | 3300025246 | Bacteria | 652154 |
| 61 | Ga0209026_1000403 | 3300025250 | Bacteria | 38393 |
| 62 | Ga0209673_1000083 | 3300025273 | Bacteria | 216509 |
| 63 | Ga0209564_1001902 | 3300025295 | Bacteria | 18709 |
| 64 | Ga0209564_1007541 | 3300025295 | Bacteria | 5603 |
| 65 | Ga0209758_1001318 | 3300025297 | Bacteria | 30178 |
| 66 | Ga0209758_1004241 | 3300025297 | Bacteria | 12130 |
| 67 | Ga0209050_1000273 | 3300025298 | Bacteria | 110451 |
| 68 | Ga0207426_1000339 | 3300025302 | Bacteria | 87978 |
| 69 | Ga0207426_1001089 | 3300025302 | Bacteria | 25231 |
| 70 | Ga0209257_1003330 | 3300025304 | Bacteria | 13906 |
| 71 | Ga0207656_10005151 | 3300025321 | Bacteria | 4596 |
| 72 | Ga0207656_10013780 | 3300025321 | Bacteria | 3099 |
| 73 | Ga0207699_10051685 | 3300025906 | Bacteria | 2429 |
| 74 | Ga0207684_10171275 | 3300025910 | Bacteria | 1872 |
| 75 | Ga0207681_10056619 | 3300025923 | Bacteria | 2675 |
| 76 | Ga0207700_10000183 | 3300025928 | Bacteria | 37732 |
| 77 | Ga0207664_10003449 | 3300025929 | Bacteria | 10541 |
| 78 | Ga0207665_10008903 | 3300025939 | Bacteria | 6592 |
| 79 | Ga0207689_10112195 | 3300025942 | Bacteria | 2241 |
| 80 | Ga0207679_10174914 | 3300025945 | Bacteria | 1771 |
| 81 | Ga0207712_10109675 | 3300025961 | Bacteria | 2068 |
| 82 | Ga0207675_100006556 | 3300026118 | Bacteria | 11014 |
| 83 | Ga0209489_112195 | 3300027361 | Bacteria | 8043 |
| 84 | Ga0268264_10425399 | 3300028381 | Bacteria | 1282 |
| 85 | Ga0307517_10006167 | 3300028786 | Bacteria | 17857 |
| 86 | Ga0307515_10000794 | 3300028794 | Bacteria | 72827 |
| 87 | Ga0307515_10108549 | 3300028794 | Bacteria | 3269 |
| 88 | Ga0265332_10006680 | 3300031238 | Bacteria | 5224 |
| 89 | Ga0307509_10000070 | 3300031507 | Bacteria | 141228 |
| 90 | Ga0307509_10033710 | 3300031507 | Bacteria | 5634 |
| 91 | Ga0307408_100062479 | 3300031548 | Bacteria | 2722 |
| 92 | Ga0307508_10010922 | 3300031616 | Bacteria | 8306 |
| 93 | Ga0307514_10001361 | 3300031649 | Bacteria | 30951 |
| 94 | Ga0307405_10020007 | 3300031731 | Bacteria | 3731 |
| 95 | Ga0307413_10003804 | 3300031824 | Bacteria | 6437 |
| 96 | Ga0307413_10252846 | 3300031824 | Bacteria | 1308 |
| 97 | Ga0307407_10000397 | 3300031903 | Bacteria | 13211 |
| 98 | Ga0307407_10049959 | 3300031903 | Bacteria | 2390 |
| 99 | Ga0307412_10008852 | 3300031911 | Bacteria | 5764 |
| 100 | Ga0307409_100007252 | 3300031995 | Bacteria | 6612 |
| 101 | Ga0307416_100043829 | 3300032002 | Bacteria | 3507 |
| 102 | Ga0307415_100081138 | 3300032126 | Bacteria | 2316 |
| 103 | Ga0373949_0000292 | 3300035090 | Bacteria | 18220 |
| 104 | Ga0373956_0149983 | 3300035119 | Bacteria | 1097 |
| 105 | Ga0436361_0302074 | 3300039447 | Bacteria | 152020 |
| 106 | Ga0436363_1689440 | 3300039450 | Bacteria | 11337 |
| 107 | Ga0495609_0003331 | 3300046538 | Bacteria | 9261 |
| 108 | Ga0495633_0000044 | 3300046558 | Bacteria | 171185 |
| 109 | Ga0495668_0000050 | 3300046616 | Bacteria | 214716 |
| 110 | Ga0495625_0003717 | 3300046660 | Bacteria | 14877 |
| 111 | Ga0495625_0167604 | 3300046660 | Bacteria | 1468 |
| 112 | Ga0496104_0120889 | 3300048907 | Bacteria | 2515 |
| 113 | Ga0496121_0000043 | 3300048924 | Bacteria | 341882 |
| 114 | Ga0496125_0000012 | 3300048928 | Bacteria | 651142 |
| 115 | Ga0501292_006607 | 3300049515 | Bacteria | 1653 |
| 116 | Ga0501201_001539 | 3300049651 | Bacteria | 2149 |
| 117 | Ga0501207_000349 | 3300049654 | Bacteria | 4989 |
| 118 | Ga0501208_001236 | 3300049655 | Bacteria | 2371 |
| 119 | Ga0501211_007871 | 3300049658 | Bacteria | 1041 |
| 120 | Ga0501217_001959 | 3300049661 | Bacteria | 3960 |
| 121 | Ga0501217_003297 | 3300049661 | Bacteria | 3253 |
| 122 | Ga0501224_002806 | 3300049664 | Bacteria | 2401 |
| 123 | Ga0501227_002588 | 3300049665 | Bacteria | 3974 |
| 124 | Ga0501228_000538 | 3300049666 | Bacteria | 2457 |
| 125 | Ga0501230_011759 | 3300049667 | Bacteria | 1392 |
| 126 | Ga0501233_000355 | 3300049668 | Bacteria | 7160 |
| 127 | Ga0501235_001578 | 3300049669 | Bacteria | 4884 |
| 128 | Ga0501240_003227 | 3300049673 | Bacteria | 1800 |
| 129 | Ga0501240_012326 | 3300049673 | Bacteria | 1168 |
| 130 | Ga0501242_002234 | 3300049674 | Bacteria | 2023 |
| 131 | Ga0501243_002864 | 3300049675 | Bacteria | 2543 |
| 132 | Ga0501243_003275 | 3300049675 | Bacteria | 2392 |
| 133 | Ga0501248_004958 | 3300049678 | Bacteria | 1029 |
| 134 | Ga0501249_004222 | 3300049679 | Bacteria | 2915 |
| 135 | Ga0501257_012125 | 3300049686 | Bacteria | 1970 |
| 136 | Ga0501258_004511 | 3300049687 | Bacteria | 1319 |
| 137 | Ga0501259_000815 | 3300049688 | Bacteria | 5118 |
| 138 | Ga0501261_000796 | 3300049690 | Bacteria | 3934 |
| 139 | Ga0501221_000083 | 3300049704 | Bacteria | 10820 |
| 140 | Ga0501225_0002327 | 3300049705 | Bacteria | 5861 |
| 141 | Ga0501225_0056891 | 3300049705 | Bacteria | 1095 |
| 142 | Ga0501234_000805 | 3300049707 | Bacteria | 4919 |
| 143 | Ga0501245_001598 | 3300049708 | Bacteria | 2949 |
| 144 | Ga0501081_0237596 | 3300049743 | Bacteria | 1328 |
| 145 | Ga0501263_000876 | 3300049760 | Bacteria | 2585 |
| 146 | Ga0501266_001683 | 3300049763 | Bacteria | 2812 |
| 147 | Ga0501268_000157 | 3300049765 | Bacteria | 6188 |
| 148 | Ga0501271_001262 | 3300049768 | Bacteria | 2151 |
| 149 | Ga0501274_001558 | 3300049771 | Bacteria | 1758 |
| 150 | Ga0501212_002395 | 3300049851 | Bacteria | 2258 |
| 151 | nmdc:mga09592_122078_c1 | 3300050508 | Bacteria | 2238 |
| 152 | nmdc:mga08y16_75509_c1 | 3300050511 | Bacteria | 3513 |
| 153 | nmdc:mga0n895_139256_c1 | 3300050512 | Bacteria | 2454 |
| 154 | nmdc:mga0n895_72664_c1 | 3300050512 | Bacteria | 3413 |
| 155 | nmdc:mga0rr50_50097_c1 | 3300050513 | Bacteria | 3093 |
| 156 | nmdc:mga0a205_19576_c1 | 3300050515 | Bacteria | 6384 |
| 157 | nmdc:mga0a205_55243_c1 | 3300050515 | Bacteria | 3836 |
| 158 | Ga0500644_0001292 | 3300053088 | Bacteria | 6811 |
| 159 | Ga0500597_010082 | 3300053120 | Unclassified | 3355 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009098 | Ga0105245_10679357 | Ga0105245_106793571 | 294 |
| 2 | 3300049768 | Ga0501271_001262 | Ga0501271_001262_324_1214 | 294 |
| 3 | 3300031548 | Ga0307408_100062479 | Ga0307408_1000624793 | 303 |
| 4 | 3300031731 | Ga0307405_10020007 | Ga0307405_100200073 | 303 |
| 5 | 3300031824 | Ga0307413_10252846 | Ga0307413_102528462 | 303 |
| 6 | 3300031903 | Ga0307407_10049959 | Ga0307407_100499593 | 303 |
| 7 | 3300031911 | Ga0307412_10008852 | Ga0307412_100088522 | 303 |
| 8 | 3300031995 | Ga0307409_100007252 | Ga0307409_1000072522 | 303 |
| 9 | 3300032002 | Ga0307416_100043829 | Ga0307416_1000438293 | 303 |
| 10 | 3300032126 | Ga0307415_100081138 | Ga0307415_1000811382 | 303 |
| 11 | 3300049515 | Ga0501292_006607 | Ga0501292_006607_105_1022 | 303 |
| 12 | 3300049651 | Ga0501201_001539 | Ga0501201_001539_1087_2004 | 303 |
| 13 | 3300049654 | Ga0501207_000349 | Ga0501207_000349_3682_4599 | 303 |
| 14 | 3300049655 | Ga0501208_001236 | Ga0501208_001236_383_1300 | 303 |
| 15 | 3300049658 | Ga0501211_007871 | Ga0501211_007871_43_960 | 303 |
| 16 | 3300049661 | Ga0501217_001959 | Ga0501217_001959_1850_2767 | 303 |
| 17 | 3300049664 | Ga0501224_002806 | Ga0501224_002806_1401_2318 | 303 |
| 18 | 3300049665 | Ga0501227_002588 | Ga0501227_002588_1150_2067 | 303 |
| 19 | 3300049666 | Ga0501228_000538 | Ga0501228_000538_305_1222 | 303 |
| 20 | 3300049667 | Ga0501230_011759 | Ga0501230_011759_145_1062 | 303 |
| 21 | 3300049668 | Ga0501233_000355 | Ga0501233_000355_5354_6271 | 303 |
| 22 | 3300049669 | Ga0501235_001578 | Ga0501235_001578_1206_2123 | 303 |
| 23 | 3300049673 | Ga0501240_003227 | Ga0501240_003227_848_1765 | 303 |
| 24 | 3300049674 | Ga0501242_002234 | Ga0501242_002234_928_1845 | 303 |
| 25 | 3300049675 | Ga0501243_003275 | Ga0501243_003275_73_990 | 303 |
| 26 | 3300049678 | Ga0501248_004958 | Ga0501248_004958_25_942 | 303 |
| 27 | 3300049679 | Ga0501249_004222 | Ga0501249_004222_753_1670 | 303 |
| 28 | 3300049686 | Ga0501257_012125 | Ga0501257_012125_62_979 | 303 |
| 29 | 3300049687 | Ga0501258_004511 | Ga0501258_004511_357_1274 | 303 |
| 30 | 3300049688 | Ga0501259_000815 | Ga0501259_000815_1008_1925 | 303 |
| 31 | 3300049690 | Ga0501261_000796 | Ga0501261_000796_556_1473 | 303 |
| 32 | 3300049704 | Ga0501221_000083 | Ga0501221_000083_966_1883 | 303 |
| 33 | 3300049705 | Ga0501225_0002327 | Ga0501225_0002327_65_982 | 303 |
| 34 | 3300049707 | Ga0501234_000805 | Ga0501234_000805_823_1740 | 303 |
| 35 | 3300049708 | Ga0501245_001598 | Ga0501245_001598_1320_2237 | 303 |
| 36 | 3300049760 | Ga0501263_000876 | Ga0501263_000876_539_1456 | 303 |
| 37 | 3300049763 | Ga0501266_001683 | Ga0501266_001683_1617_2534 | 303 |
| 38 | 3300049765 | Ga0501268_000157 | Ga0501268_000157_152_1069 | 303 |
| 39 | 3300049771 | Ga0501274_001558 | Ga0501274_001558_291_1208 | 303 |
| 40 | 3300049851 | Ga0501212_002395 | Ga0501212_002395_558_1475 | 303 |
| 41 | 3300025910 | Ga0207684_10171275 | Ga0207684_101712752 | 314 |
| 42 | 3300005471 | Ga0070698_100056411 | Ga0070698_1000564115 | 317 |
| 43 | 3300006175 | Ga0070712_100186701 | Ga0070712_1001867012 | 318 |
| 44 | 3300025928 | Ga0207700_10000183 | Ga0207700_1000018329 | 318 |
| 45 | 3300049675 | Ga0501243_002864 | Ga0501243_002864_1542_2528 | 323 |
| 46 | 3300005544 | Ga0070686_100102404 | Ga0070686_1001024041 | 327 |
| 47 | 3300013102 | Ga0157371_10004684 | Ga0157371_100046846 | 327 |
| 48 | 3300013105 | Ga0157369_10187184 | Ga0157369_101871842 | 327 |
| 49 | 3300028794 | Ga0307515_10108549 | Ga0307515_101085493 | 327 |
| 50 | 3300017792 | Ga0163161_10000576 | Ga0163161_1000057618 | 328 |
| 51 | 3300005330 | Ga0070690_100001626 | Ga0070690_1000016269 | 329 |
| 52 | 3300025961 | Ga0207712_10109675 | Ga0207712_101096752 | 329 |
| 53 | 3300053088 | Ga0500644_0001292 | Ga0500644_0001292_5732_6724 | 329 |
| 54 | 3300053120 | Ga0500597_010082 | Ga0500597_010082_356_1423 | 329 |
| 55 | 3300005843 | Ga0068860_100452995 | Ga0068860_1004529951 | 330 |
| 56 | 3300028381 | Ga0268264_10425399 | Ga0268264_104253991 | 330 |
| 57 | 3300005337 | Ga0070682_100000060 | Ga0070682_10000006013 | 331 |
| 58 | 3300006880 | Ga0075429_100150864 | Ga0075429_1001508641 | 331 |
| 59 | 3300015261 | Ga0182006_1009363 | Ga0182006_10093632 | 331 |
| 60 | 3300015261 | Ga0182006_1039332 | Ga0182006_10393321 | 331 |
| 61 | 3300035119 | Ga0373956_0149983 | Ga0373956_0149983_50_1081 | 331 |
| 62 | 3300039450 | Ga0436363_1689440 | Ga0436363_1689440_5356_6402 | 331 |
| 63 | 3300050508 | nmdc:mga09592_122078_c1 | nmdc:mga09592_122078_c1_1073_2125 | 331 |
| 64 | 3300005548 | Ga0070665_100068602 | Ga0070665_1000686024 | 333 |
| 65 | 3300006852 | Ga0075433_10073359 | Ga0075433_100733594 | 333 |
| 66 | 3300050512 | nmdc:mga0n895_139256_c1 | nmdc:mga0n895_139256_c1_1175_2188 | 333 |
| 67 | 3300050515 | nmdc:mga0a205_19576_c1 | nmdc:mga0a205_19576_c1_2578_3618 | 333 |
| 68 | 3300031649 | Ga0307514_10001361 | Ga0307514_100013616 | 334 |
| 69 | 3300013296 | Ga0157374_10350760 | Ga0157374_103507601 | 335 |
| 70 | 3300005937 | Ga0081455_10070176 | Ga0081455_100701761 | 336 |
| 71 | 3300049661 | Ga0501217_003297 | Ga0501217_003297_312_1337 | 336 |
| 72 | 3300049673 | Ga0501240_012326 | Ga0501240_012326_52_1077 | 336 |
| 73 | 3300049705 | Ga0501225_0056891 | Ga0501225_0056891_21_1046 | 336 |
| 74 | 3300005834 | Ga0068851_10005394 | Ga0068851_100053944 | 337 |
| 75 | 3300025321 | Ga0207656_10013780 | Ga0207656_100137803 | 337 |
| 76 | 3300048924 | Ga0496121_0000043 | Ga0496121_0000043_270945_271967 | 337 |
| 77 | iso_pu_bacteria | 2739367857 | 2740001579 | 337 |
| 78 | iso_pu_bacteria | 2739367858 | 2740006395 | 337 |
| 79 | 3300031238 | Ga0265332_10006680 | Ga0265332_100066804 | 339 |
| 80 | 3300031507 | Ga0307509_10000070 | Ga0307509_1000007021 | 339 |
| 81 | 3300031616 | Ga0307508_10010922 | Ga0307508_100109224 | 339 |
| 82 | 3300005434 | Ga0070709_10078804 | Ga0070709_100788042 | 340 |
| 83 | 3300005435 | Ga0070714_100014672 | Ga0070714_1000146722 | 340 |
| 84 | 3300005436 | Ga0070713_100015395 | Ga0070713_1000153956 | 340 |
| 85 | 3300005471 | Ga0070698_100254483 | Ga0070698_1002544832 | 340 |
| 86 | 3300005518 | Ga0070699_100000012 | Ga0070699_100000012181 | 340 |
| 87 | 3300005617 | Ga0068859_100105379 | Ga0068859_1001053793 | 340 |
| 88 | 3300006028 | Ga0070717_10033012 | Ga0070717_100330123 | 340 |
| 89 | 3300006931 | Ga0097620_100105380 | Ga0097620_1001053803 | 340 |
| 90 | 3300021361 | Ga0213872_10001110 | Ga0213872_1000111012 | 340 |
| 91 | 3300025906 | Ga0207699_10051685 | Ga0207699_100516852 | 340 |
| 92 | 3300025929 | Ga0207664_10003449 | Ga0207664_100034495 | 340 |
| 93 | 3300026118 | Ga0207675_100006556 | Ga0207675_1000065564 | 340 |
| 94 | 3300035090 | Ga0373949_0000292 | Ga0373949_0000292_16704_17732 | 340 |
| 95 | 3300039447 | Ga0436361_0302074 | Ga0436361_0302074_143716_144753 | 340 |
| 96 | 3300048907 | Ga0496104_0120889 | Ga0496104_0120889_151_1185 | 340 |
| 97 | 3300049743 | Ga0501081_0237596 | Ga0501081_0237596_248_1288 | 340 |
| 98 | iso_pu_bacteria | 8055419101 | 8055422438 | 340 |
| 99 | iso_pu_bacteria | 8055419101 | 8055423790 | 340 |
| 100 | 3300005347 | Ga0070668_100027189 | Ga0070668_1000271892 | 341 |
| 101 | 3300005353 | Ga0070669_100048439 | Ga0070669_1000484392 | 341 |
| 102 | 3300005354 | Ga0070675_100096033 | Ga0070675_1000960332 | 341 |
| 103 | 3300005457 | Ga0070662_100120382 | Ga0070662_1001203822 | 341 |
| 104 | 3300006871 | Ga0075434_100178811 | Ga0075434_1001788112 | 341 |
| 105 | 3300025923 | Ga0207681_10056619 | Ga0207681_100566192 | 341 |
| 106 | 3300025939 | Ga0207665_10008903 | Ga0207665_100089034 | 341 |
| 107 | 3300003322 | rootL2_10262583 | rootL2_102625831 | 342 |
| 108 | 3300001989 | JGI24739J22299_10044009 | JGI24739J22299_100440092 | 343 |
| 109 | 3300003203 | JGI25406J46586_10000216 | JGI25406J46586_1000021617 | 343 |
| 110 | 3300003215 | JGI25153J46596_10008628 | JGI25153J46596_100086282 | 343 |
| 111 | 3300003771 | Ga0055526_1017812 | Ga0055526_10178121 | 343 |
| 112 | 3300003790 | Ga0055528_1000738 | Ga0055528_10007389 | 343 |
| 113 | 3300005262 | Ga0065165_1000017 | Ga0065165_1000017109 | 343 |
| 114 | 3300005288 | Ga0065714_10103531 | Ga0065714_101035312 | 343 |
| 115 | 3300005365 | Ga0070688_100175363 | Ga0070688_1001753632 | 343 |
| 116 | 3300005438 | Ga0070701_10207362 | Ga0070701_102073621 | 343 |
| 117 | 3300005440 | Ga0070705_100128336 | Ga0070705_1001283362 | 343 |
| 118 | 3300005564 | Ga0070664_100150425 | Ga0070664_1001504252 | 343 |
| 119 | 3300005617 | Ga0068859_100003639 | Ga0068859_10000363910 | 343 |
| 120 | 3300005985 | Ga0081539_10000047 | Ga0081539_1000004738 | 343 |
| 121 | 3300006852 | Ga0075433_10003470 | Ga0075433_1000347010 | 343 |
| 122 | 3300006931 | Ga0097620_100003639 | Ga0097620_10000363910 | 343 |
| 123 | 3300009094 | Ga0111539_10122107 | Ga0111539_101221072 | 343 |
| 124 | 3300025273 | Ga0209673_1000083 | Ga0209673_1000083119 | 343 |
| 125 | 3300025295 | Ga0209564_1001902 | Ga0209564_100190218 | 343 |
| 126 | 3300025295 | Ga0209564_1007541 | Ga0209564_10075414 | 343 |
| 127 | 3300025297 | Ga0209758_1001318 | Ga0209758_100131823 | 343 |
| 128 | 3300025297 | Ga0209758_1004241 | Ga0209758_10042413 | 343 |
| 129 | 3300025298 | Ga0209050_1000273 | Ga0209050_100027333 | 343 |
| 130 | 3300025302 | Ga0207426_1001089 | Ga0207426_100108916 | 343 |
| 131 | 3300025304 | Ga0209257_1003330 | Ga0209257_100333015 | 343 |
| 132 | 3300025945 | Ga0207679_10174914 | Ga0207679_101749142 | 343 |
| 133 | 3300031824 | Ga0307413_10003804 | Ga0307413_100038046 | 343 |
| 134 | 3300031903 | Ga0307407_10000397 | Ga0307407_100003974 | 343 |
| 135 | 3300050511 | nmdc:mga08y16_75509_c1 | nmdc:mga08y16_75509_c1_1041_2084 | 343 |
| 136 | 3300050512 | nmdc:mga0n895_72664_c1 | nmdc:mga0n895_72664_c1_1096_2139 | 343 |
| 137 | 3300050513 | nmdc:mga0rr50_50097_c1 | nmdc:mga0rr50_50097_c1_563_1606 | 343 |
| 138 | 3300050515 | nmdc:mga0a205_55243_c1 | nmdc:mga0a205_55243_c1_727_1770 | 343 |
| 139 | 3300006942 | Ga0099824_1009673 | Ga0099824_100967312 | 344 |
| 140 | 3300006948 | Ga0099826_10001865 | Ga0099826_100018658 | 344 |
| 141 | 3300017792 | Ga0163161_10000070 | Ga0163161_1000007055 | 344 |
| 142 | 3300027361 | Ga0209489_112195 | Ga0209489_1121956 | 344 |
| 143 | 3300046616 | Ga0495668_0000050 | Ga0495668_0000050_30381_31508 | 344 |
| 144 | 3300048928 | Ga0496125_0000012 | Ga0496125_0000012_547601_548653 | 344 |
| 145 | iso_pu_bacteria | 2929921140 | 2929924543 | 344 |
| 146 | 3300005834 | Ga0068851_10000066 | Ga0068851_1000006640 | 345 |
| 147 | 3300025321 | Ga0207656_10005151 | Ga0207656_100051513 | 345 |
| 148 | 3300025942 | Ga0207689_10112195 | Ga0207689_101121951 | 345 |
| 149 | 3300005288 | Ga0065714_10006600 | Ga0065714_100066001 | 346 |
| 150 | 3300005365 | Ga0070688_100043339 | Ga0070688_1000433392 | 346 |
| 151 | 3300005438 | Ga0070701_10030254 | Ga0070701_100302542 | 346 |
| 152 | 3300031507 | Ga0307509_10033710 | Ga0307509_100337102 | 346 |
| 153 | 3300046538 | Ga0495609_0003331 | Ga0495609_0003331_4738_5796 | 346 |
| 154 | 3300028786 | Ga0307517_10006167 | Ga0307517_1000616714 | 347 |
| 155 | 3300028794 | Ga0307515_10000794 | Ga0307515_1000079412 | 347 |
| 156 | 3300046558 | Ga0495633_0000044 | Ga0495633_0000044_39890_40951 | 347 |
| 157 | 3300046660 | Ga0495625_0003717 | Ga0495625_0003717_3651_4712 | 347 |
| 158 | 3300046660 | Ga0495625_0167604 | Ga0495625_0167604_213_1277 | 347 |
| 159 | iso_pu_bacteria | 2977232053 | 2977233493 | 347 |
| 160 | 3300001979 | JGI24740J21852_10001518 | JGI24740J21852_100015185 | 348 |
| 161 | 3300002738 | JGI25154J39366_1000031 | JGI25154J39366_100003167 | 348 |
| 162 | 3300003215 | JGI25153J46596_10010152 | JGI25153J46596_100101522 | 348 |
| 163 | 3300025246 | Ga0209646_1000009 | Ga0209646_1000009338 | 348 |
| 164 | 3300025250 | Ga0209026_1000403 | Ga0209026_100040320 | 348 |
| 165 | 3300025302 | Ga0207426_1000339 | Ga0207426_100033976 | 348 |
| 166 | iso_pu_bacteria | 8003151029 | 8003157006 | 348 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3wmr-assembly3.cif.gz_C | crystal structure of vinj | 0.9225 | 47 | 338 |
| 7a6g-assembly1.cif.gz_A | structural characterization of l-proline amide hydrolase from pseudomonas syringae | 0.9158 | 46 | 337 |
| 1xrp-assembly1.cif.gz_A | crystal structure of active site f1-mutant e213q soaked with peptide pro-leu-gly-gly | 0.9093 | 46 | 337 |
| 3wmr-assembly3.cif.gz_C | crystal structure of vinj | 0.9076 | 47 | 338 |
| 1xqx-assembly1.cif.gz_A | crystal structure of f1-mutant s105a complex with pck | 0.9075 | 46 | 337 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6Y8X0_7_285_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9485 | 60 | 337 | 3.40.50.1820 |
| af_I6Y8X0_7_285_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9222 | 60 | 337 | 3.40.50.1820 |
| 3wmrB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9175 | 47 | 338 | 3.40.50.1820 |
| 1xrpA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9093 | 46 | 337 | 3.40.50.1820 |
| 3wmrB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9027 | 47 | 338 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519SZ51-F1-model_v4 | Alpha/beta fold hydrolase | 0.9929 | 60 | 341 |
GO:0006508
GO:0008233 GO:0016020 |
| AF-A0A519RR88-F1-model_v4 | Alpha/beta fold hydrolase | 0.9918 | 29 | 341 |
GO:0006508
GO:0008233 GO:0016020 |
| AF-A0A350BVS3-F1-model_v4 | Proline iminopeptidase | 0.9918 | 49 | 342 |
GO:0004177
GO:0006508 GO:0016020 |
| AF-A0A524BIX1-F1-model_v4 | Proline iminopeptidase | 0.9901 | 46 | 337 |
GO:0004177
GO:0006508 |
| AF-A0A848QFN0-F1-model_v4 | deleted | 0.9888 | 33 | 340 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar