F249453

General Info

Members Datasets Scaffolds Average Seq Length
166 137 332 326

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2895442618|2895443198
Length 326
Sequence HRVVFVVFDGMKMLDLAGPAEVFAEANLFGARYALRRVSPSGKPVLTSTGMELPVDGTAEDGPGAGPDTVIVVGGDVLATHPVPPELITTIQSFRPRARRMVSICTGSFALAAAGVLAGRRATTHWRHARLLACAHPDVHVQPDALFVEDDGVFTSAGVSAGIDLALALVEQDHGPDLARDVARGLVMFMQRPGGQSQFSAPLEAKPPRTPTLRRIVDLIAAQPALDHTVSTLARRVAVSPRHLARLFATELNTTPAKYVEQVRLDHAKVLLAAGHGVAETARVAGFGSAETMRRTFTARLGISPSQYRTRFATTGPGRQKPGNDR

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
18 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
19 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
20 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
21 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
22 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
23 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
24 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
25 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
26 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
38 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
39 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
40 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
41 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
42 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
43 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
44 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
45 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
46 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
47 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
48 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
49 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
50 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
51 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
52 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
53 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
54 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
55 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
56 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
57 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
58 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
59 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
60 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
61 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
62 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
63 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
64 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
65 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
66 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
67 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
68 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
69 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
70 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
71 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
72 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
73 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
74 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
75 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
76 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
77 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
78 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
79 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
80 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
81 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
82 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
83 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
84 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
85 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
86 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
87 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
88 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
89 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
90 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
91 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
92 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
93 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
102 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
103 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
104 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
106 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
107 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
108 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
109 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
110 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
111 2643221696 Nocardioides sp. Root140 Isolate Unclassified
112 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
113 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
114 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
115 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
116 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
117 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
118 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
119 2858882152 Micromonospora noduli MED15 Isolate Nodule
120 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
121 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
122 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
123 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
124 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
125 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
126 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
127 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
128 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
129 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
130 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
131 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
132 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
133 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
134 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
135 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
136 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
137 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.13
Metatranscriptomes 0
Isolates 16.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.61
Nodule 1.2
Rhizoplane 9.64
Rhizosphere 70.48
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10004668 3300003215 Bacteria 7323
2 rootL2_10078366 3300003322 Bacteria 2969
3 rootH1_10211978 3300003323 Bacteria 2528
4 Ga0070658_10184513 3300005327 Bacteria 1756
5 Ga0070680_100051468 3300005336 Bacteria 3360
6 Ga0070691_10054842 3300005341 Bacteria 1908
7 Ga0070674_100123892 3300005356 Bacteria 1917
8 Ga0070709_10249056 3300005434 Bacteria 1279
9 Ga0070714_100044921 3300005435 Bacteria 3741
10 Ga0070684_100129518 3300005535 Bacteria 2275
11 Ga0070684_100480586 3300005535 Bacteria 1150
12 Ga0070686_100146710 3300005544 Bacteria 1648
13 Ga0070665_100060661 3300005548 Bacteria 3791
14 Ga0070704_100198108 3300005549 Bacteria 1619
15 Ga0068857_100421877 3300005577 Bacteria 1244
16 Ga0068856_100229324 3300005614 Bacteria 1872
17 Ga0081455_10047924 3300005937 Bacteria 3696
18 Ga0075369_10029017 3300006186 Bacteria 2322
19 Ga0105250_10018641 3300009092 Bacteria 2810
20 Ga0105245_10467880 3300009098 Bacteria 1272
21 Ga0105237_10490393 3300009545 Bacteria 1235
22 Ga0105238_10041088 3300009551 Bacteria 4684
23 Ga0105249_10003837 3300009553 Bacteria 12971
24 Ga0105035_100663 3300009988 Bacteria 2158
25 Ga0157370_10036108 3300013104 Bacteria 4798
26 Ga0209758_1004507 3300025297 Bacteria 11550
27 Ga0207707_10007812 3300025912 Bacteria 9306
28 Ga0207693_10123710 3300025915 Bacteria 2032
29 Ga0207660_10083669 3300025917 Bacteria 2350
30 Ga0207700_10060954 3300025928 Bacteria 2859
31 Ga0207700_10108608 3300025928 Bacteria 2228
32 Ga0207664_10004183 3300025929 Bacteria 9751
33 Ga0207644_10058392 3300025931 Bacteria 2789
34 Ga0207665_10022546 3300025939 Bacteria 4144
35 Ga0207665_10261943 3300025939 Bacteria 1281
36 Ga0207712_10047793 3300025961 Bacteria 2973
37 Ga0207658_10385988 3300025986 Bacteria 1228
38 Ga0207675_100129501 3300026118 Bacteria 2392
39 Ga0268266_10012299 3300028379 Bacteria 7405
40 Ga0268266_10101577 3300028379 Bacteria 2536
41 Ga0395900_0045339 3300037418 Bacteria 4529
42 Ga0395898_0036257 3300037466 Bacteria 4897
43 Ga0395898_0043179 3300037466 Bacteria 4443
44 Ga0466969_0030334 3300044656 Bacteria 2756
45 Ga0466972_0035429 3300044658 Bacteria 2442
46 Ga0466972_0057239 3300044658 Bacteria 1872
47 Ga0466972_0065162 3300044658 Bacteria 1743
48 Ga0466965_0006787 3300044683 Bacteria 5226
49 Ga0466966_0201966 3300044684 Bacteria 1203
50 Ga0466961_0071395 3300044693 Bacteria 2203
51 Ga0466961_0077532 3300044693 Bacteria 2105
52 Ga0466961_0092219 3300044693 Bacteria 1912
53 Ga0466964_0034706 3300044706 Bacteria 2014
54 Ga0466971_0007720 3300044719 Bacteria 4690
55 Ga0466968_0021772 3300044735 Bacteria 2598
56 Ga0466968_0029031 3300044735 Bacteria 2285
57 Ga0466970_0026956 3300044765 Bacteria 3012
58 Ga0466970_0102470 3300044765 Bacteria 1559
59 Ga0466957_0010844 3300044842 Bacteria 5240
60 Ga0466960_0009105 3300044901 Bacteria 4084
61 Ga0466960_0016366 3300044901 Bacteria 3215
62 Ga0466959_0034325 3300045049 Bacteria 3752
63 Ga0466958_0057271 3300045836 Bacteria 2369
64 Ga0466958_0069738 3300045836 Bacteria 2150
65 Ga0466958_0142620 3300045836 Bacteria 1509
66 Ga0466967_0025086 3300045976 Bacteria 4911
67 Ga0495603_0001061 3300046455 Bacteria 15917
68 Ga0495603_0001293 3300046455 Bacteria 14584
69 Ga0495629_0009587 3300046459 Bacteria 7073
70 Ga0495605_0017511 3300046474 Bacteria 3854
71 Ga0495594_0000673 3300046499 Bacteria 17612
72 Ga0495594_0002414 3300046499 Bacteria 9729
73 Ga0495607_0019683 3300046501 Bacteria 4284
74 Ga0495606_0019987 3300046507 Bacteria 4956
75 Ga0495616_0020119 3300046513 Bacteria 3636
76 Ga0495620_0018896 3300046515 Bacteria 3404
77 Ga0495643_0016809 3300046522 Bacteria 4293
78 Ga0495648_0017671 3300046524 Bacteria 5088
79 Ga0495666_0115964 3300046526 Bacteria 1256
80 Ga0495665_0044091 3300046531 Bacteria 2371
81 Ga0495622_0000930 3300046557 Bacteria 15815
82 Ga0495622_0024058 3300046557 Bacteria 2843
83 Ga0495611_0000846 3300046648 Bacteria 16790
84 Ga0495588_0037191 3300046674 Bacteria 2472
85 Ga0495613_0120839 3300046689 Bacteria 1881
86 Ga0495589_0013526 3300046794 Bacteria 4209
87 Ga0495660_0003588 3300046810 Bacteria 9569
88 Ga0495581_0114719 3300047315 Bacteria 1567
89 Ga0495676_0001725 3300047321 Bacteria 19106
90 Ga0495676_0002076 3300047321 Bacteria 17640
91 Ga0495676_0002548 3300047321 Bacteria 16216
92 Ga0495687_011360 3300047443 Bacteria 4797
93 Ga0495685_011506 3300047447 Bacteria 2987
94 Ga0495686_0009660 3300047472 Bacteria 6929
95 Ga0495626_0037048 3300048091 Bacteria 2320
96 Ga0496100_0000778 3300048903 Bacteria 15210
97 Ga0496101_0001459 3300048904 Bacteria 14115
98 Ga0496101_0208585 3300048904 Bacteria 1513
99 Ga0496102_0266528 3300048905 Bacteria 1615
100 Ga0496102_0289893 3300048905 Bacteria 1543
101 Ga0496104_0003825 3300048907 Bacteria 13032
102 Ga0496105_0076066 3300048908 Bacteria 2772
103 Ga0496106_0008460 3300048909 Bacteria 7613
104 Ga0496107_0000357 3300048910 Bacteria 24928
105 Ga0496108_0093270 3300048911 Bacteria 2561
106 Ga0496109_0324552 3300048912 Bacteria 1453
107 Ga0496111_0247669 3300048914 Bacteria 1323
108 Ga0496112_0119348 3300048915 Bacteria 2607
109 Ga0496112_0189047 3300048915 Bacteria 2022
110 Ga0496114_0000539 3300048917 Bacteria 27935
111 Ga0496115_0072754 3300048918 Bacteria 2789
112 Ga0496117_0034501 3300048920 Bacteria 3811
113 Ga0496126_0013639 3300048929 Bacteria 8249
114 Ga0496126_0195758 3300048929 Bacteria 1709
115 Ga0495678_027020 3300049459 Bacteria 2440
116 Ga0501032_0001507 3300049569 Bacteria 18605
117 Ga0501033_0021007 3300049570 Bacteria 4929
118 Ga0501034_0002401 3300049571 Bacteria 22695
119 Ga0501034_0023463 3300049571 Bacteria 6286
120 Ga0501036_0000204 3300049572 Bacteria 39411
121 Ga0501036_0005535 3300049572 Bacteria 10247
122 Ga0501036_0006609 3300049572 Bacteria 9421
123 Ga0501037_0001937 3300049573 Bacteria 14980
124 Ga0501038_0006552 3300049574 Bacteria 10768
125 Ga0501038_0112756 3300049574 Bacteria 2251
126 Ga0501039_0007285 3300049575 Bacteria 8426
127 Ga0501039_0009237 3300049575 Bacteria 7512
128 Ga0501043_0000886 3300049579 Bacteria 26553
129 Ga0501070_0000803 3300049586 Bacteria 28511
130 Ga0501070_0005201 3300049586 Bacteria 11086
131 Ga0501073_0044800 3300049589 Bacteria 3118
132 Ga0501074_0000276 3300049590 Bacteria 29509
133 Ga0501035_0002082 3300049822 Bacteria 19908
134 Ga0501044_0013837 3300049823 Bacteria 8720
135 Ga0500635_0000002 3300053080 Bacteria 265613
136 Ga0500556_0000842 3300053104 Bacteria 17570
137 Ga0500616_0000027 3300053153 Bacteria 441053
138 Ga0466962_0036524 3300061719 Bacteria 2352
139 2895443198 2895442618 Bacteria 11027144
140 2644531129 2643221696 Bacteria 5431823
141 2676483796 2675903059 Bacteria 8644972
142 2760623494 2758568621 Bacteria 5967089
143 2795781935 2795385470 Bacteria 8317180
144 2855673235 2855670206 Bacteria 7120389
145 2855681032 2855676851 Bacteria 7063653
146 2857293573 2857288857 Bacteria 7189066
147 2858851381 2858848962 Bacteria 6963058
148 2858887633 2858882152 Bacteria 7230291
149 2858892753 2858888857 Bacteria 7060307
150 2858896999 2858895516 Bacteria 7378898
151 2867303195 2867302475 Bacteria 7087181
152 2867314143 2867312974 Bacteria 7058875
153 2867321448 2867319477 Bacteria 7069771
154 2869053018 2869048445 Bacteria 6875584
155 2869067044 2869061728 Bacteria 7112407
156 2869070199 2869068681 Bacteria 7205615
157 2870788682 2870782633 Bacteria 9624083
158 2884699599 2884693830 Bacteria 11273186
159 2891401608 2891395885 Bacteria 9251614
160 2929224139 2929219909 Bacteria 6984360
161 2929229171 2929226422 Bacteria 7248583
162 2996221948 2996221748 Bacteria 6799777
163 8003833718 8003830390 Bacteria 6541657
164 8003872967 8003870546 Bacteria 7396674
165 8008581794 8008574985 Bacteria 7815457
166 8057347521 8057345674 Bacteria 4160394
167 JGI25153J46596_10004668
168 rootL2_10078366
169 rootH1_10211978
170 Ga0070658_10184513
171 Ga0070680_100051468
172 Ga0070691_10054842
173 Ga0070674_100123892
174 Ga0070709_10249056
175 Ga0070714_100044921
176 Ga0070684_100129518
177 Ga0070684_100480586
178 Ga0070686_100146710
179 Ga0070665_100060661
180 Ga0070704_100198108
181 Ga0068857_100421877
182 Ga0068856_100229324
183 Ga0081455_10047924
184 Ga0075369_10029017
185 Ga0105250_10018641
186 Ga0105245_10467880
187 Ga0105237_10490393
188 Ga0105238_10041088
189 Ga0105249_10003837
190 Ga0105035_100663
191 Ga0157370_10036108
192 Ga0209758_1004507
193 Ga0207707_10007812
194 Ga0207693_10123710
195 Ga0207660_10083669
196 Ga0207700_10060954
197 Ga0207700_10108608
198 Ga0207664_10004183
199 Ga0207644_10058392
200 Ga0207665_10022546
201 Ga0207665_10261943
202 Ga0207712_10047793
203 Ga0207658_10385988
204 Ga0207675_100129501
205 Ga0268266_10012299
206 Ga0268266_10101577
207 Ga0395900_0045339
208 Ga0395898_0036257
209 Ga0395898_0043179
210 Ga0466969_0030334
211 Ga0466972_0035429
212 Ga0466972_0057239
213 Ga0466972_0065162
214 Ga0466965_0006787
215 Ga0466966_0201966
216 Ga0466961_0071395
217 Ga0466961_0077532
218 Ga0466961_0092219
219 Ga0466964_0034706
220 Ga0466971_0007720
221 Ga0466968_0021772
222 Ga0466968_0029031
223 Ga0466970_0026956
224 Ga0466970_0102470
225 Ga0466957_0010844
226 Ga0466960_0009105
227 Ga0466960_0016366
228 Ga0466959_0034325
229 Ga0466958_0057271
230 Ga0466958_0069738
231 Ga0466958_0142620
232 Ga0466967_0025086
233 Ga0495603_0001061
234 Ga0495603_0001293
235 Ga0495629_0009587
236 Ga0495605_0017511
237 Ga0495594_0000673
238 Ga0495594_0002414
239 Ga0495607_0019683
240 Ga0495606_0019987
241 Ga0495616_0020119
242 Ga0495620_0018896
243 Ga0495643_0016809
244 Ga0495648_0017671
245 Ga0495666_0115964
246 Ga0495665_0044091
247 Ga0495622_0000930
248 Ga0495622_0024058
249 Ga0495611_0000846
250 Ga0495588_0037191
251 Ga0495613_0120839
252 Ga0495589_0013526
253 Ga0495660_0003588
254 Ga0495581_0114719
255 Ga0495676_0001725
256 Ga0495676_0002076
257 Ga0495676_0002548
258 Ga0495687_011360
259 Ga0495685_011506
260 Ga0495686_0009660
261 Ga0495626_0037048
262 Ga0496100_0000778
263 Ga0496101_0001459
264 Ga0496101_0208585
265 Ga0496102_0266528
266 Ga0496102_0289893
267 Ga0496104_0003825
268 Ga0496105_0076066
269 Ga0496106_0008460
270 Ga0496107_0000357
271 Ga0496108_0093270
272 Ga0496109_0324552
273 Ga0496111_0247669
274 Ga0496112_0119348
275 Ga0496112_0189047
276 Ga0496114_0000539
277 Ga0496115_0072754
278 Ga0496117_0034501
279 Ga0496126_0013639
280 Ga0496126_0195758
281 Ga0495678_027020
282 Ga0501032_0001507
283 Ga0501033_0021007
284 Ga0501034_0002401
285 Ga0501034_0023463
286 Ga0501036_0000204
287 Ga0501036_0005535
288 Ga0501036_0006609
289 Ga0501037_0001937
290 Ga0501038_0006552
291 Ga0501038_0112756
292 Ga0501039_0007285
293 Ga0501039_0009237
294 Ga0501043_0000886
295 Ga0501070_0000803
296 Ga0501070_0005201
297 Ga0501073_0044800
298 Ga0501074_0000276
299 Ga0501035_0002082
300 Ga0501044_0013837
301 Ga0500635_0000002
302 Ga0500556_0000842
303 Ga0500616_0000027
304 Ga0466962_0036524
305 2895443198
306 2644531129
307 2676483796
308 2760623494
309 2795781935
310 2855673235
311 2855681032
312 2857293573
313 2858851381
314 2858887633
315 2858892753
316 2858896999
317 2867303195
318 2867314143
319 2867321448
320 2869053018
321 2869067044
322 2869070199
323 2870788682
324 2884699599
325 2891401608
326 2929224139
327 2929229171
328 2996221948
329 8003833718
330 8003872967
331 8008581794
332 8057347521

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

233

311

0.97

PF01965

DJ-1_PfpI

DJ-1/PfpI family

1

172

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mgk-assembly1.cif.gz_A crystal structure of probable protease/amidase from clostridium acetobutylicum atcc 824 0.9212 45 229
3w6v-assembly1.cif.gz_A crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna 0.9079 250 352
3mkl-assembly2.cif.gz_B crystal structure of dna-binding transcriptional dual regulator from escherichia coli k-12 0.9075 254 351
3mkl-assembly1.cif.gz_A crystal structure of dna-binding transcriptional dual regulator from escherichia coli k-12 0.8978 255 351
3oio-assembly1.cif.gz_A crystal structure of transcriptional regulator (arac-type dna-binding domain-containing proteins) from chromobacterium violaceum 0.8967 251 355
ID Description Score Start End Superfamily
af_P96245_143_250_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9472 248 349 1.10.10.60
5suwA03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9467 302 352 1.10.10.60
af_P76241_154_259_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9345 249 351 1.10.10.60
af_P32677_219_275_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9262 304 352 1.10.10.60
af_P05052_134_237_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9224 255 351 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A3M5WS52-F1-model_v4 ThiJ/PfpI protein 0.9668 141 227 GO:0006355
AF-A0A4Q3NRS4-F1-model_v4 deleted 0.9525 253 352
AF-A0A6I1W257-F1-model_v4 AraC family transcriptional regulator 0.9497 119 208 GO:0006355
AF-A0A3M3A0T1-F1-model_v4 AraC family transcriptional regulator 0.9383 142 221 GO:0006355
AF-A0A561H2P8-F1-model_v4 deleted 0.938 248 351

Map