F249423

General Info

Members Datasets Scaffolds Average Seq Length
166 117 332 400

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2671180195|2671839692
Length 429
Sequence PDVRPALGAEAGLGFGIRIVRQPHVEGQGPLTTISADDLYYDPFDFEIDNDPYPVWRRLRDEAPLYYNERYEFYALSRYTDVAPALTDWQTYRSGKGSVLEVIRANIEIPPGVILFEDPPLHDIHRGLLARVFTPKRMSALEPKIREFTVRCLDPLVGAGTFDLIRQLGAQMPMRTIGFLLGIPESDQEAIRDRLDKGMNLEETSSEEMYSDGFLDGSMFAEYIDWRAKHPSDDLMTEMLTTEFEDETGTVRRLSREEILTYVTLLAGAGNETTTRLIGWTGKLLAEHPDQRREIARDRSLLPNAIEEILRFEAPSPIQARSVARDVELYGQTVPEGSIMTLLNASANRDERHFPDPDIFDIHRRIDRHLSFGYGIHFCLGASLARLEGRVALDELLNRWTDWDVDWGNAKLAHTSTARGWERLPVTLG

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
3 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
4 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
5 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
6 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
7 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
8 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
10 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
12 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
13 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
14 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
15 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
16 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
17 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
18 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
19 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
20 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
21 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
22 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
23 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
24 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
34 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
35 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
36 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
37 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
38 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
39 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
40 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
41 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
42 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
43 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
44 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
45 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
46 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
47 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
48 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
49 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
50 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
51 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
52 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
53 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
54 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
55 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
56 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
57 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
58 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
59 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
60 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
61 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
62 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
63 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
64 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
65 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
66 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
67 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
68 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
69 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
70 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
71 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
72 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
73 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
74 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
75 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
76 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
77 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
78 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
79 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
80 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
81 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
89 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
90 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
91 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
92 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
93 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
94 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
95 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
97 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
98 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
99 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
100 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
101 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
102 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
103 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
104 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
105 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
106 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
107 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
108 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
109 2671180195 Frankia sp. CcI49 Isolate Nodule
110 2517572101 Frankia sp. DC12 Isolate Nodule
111 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
112 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
113 2773857922 Frankia sp. CcI49 Isolate Nodule
114 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
115 8002775197 Frankia nepalensis CN7 Isolate Nodule
116 8002784119 Frankia sp. AgB1.9 Isolate Nodule
117 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.77
Metatranscriptomes 0
Isolates 7.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.61
Nodule 6.02
Rhizoplane 6.02
Rhizosphere 80.72
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100113608 3300005355 Bacteria 2276
2 Ga0070708_100006496 3300005445 Bacteria 9301
3 Ga0070681_10059149 3300005458 Bacteria 3811
4 Ga0070707_100020347 3300005468 Bacteria 6259
5 Ga0070698_100185761 3300005471 Bacteria 2016
6 Ga0070699_100109489 3300005518 Bacteria 2424
7 Ga0070672_100284382 3300005543 Bacteria 1399
8 Ga0081455_10029225 3300005937 Bacteria 5027
9 Ga0081455_10095747 3300005937 Bacteria 2396
10 Ga0081538_10053100 3300005981 Bacteria 2413
11 Ga0081539_10011414 3300005985 Bacteria 7022
12 Ga0075363_100000488 3300006048 Bacteria 12574
13 Ga0075363_100087059 3300006048 Bacteria 1716
14 Ga0075428_100002060 3300006844 Bacteria 21681
15 Ga0075428_100235880 3300006844 Bacteria 1974
16 Ga0075430_100002513 3300006846 Bacteria 15290
17 Ga0075430_100004234 3300006846 Bacteria 12115
18 Ga0075430_100148504 3300006846 Bacteria 1952
19 Ga0075431_100001429 3300006847 Bacteria 21961
20 Ga0075431_100003675 3300006847 Bacteria 14893
21 Ga0075429_100001232 3300006880 Bacteria 20741
22 Ga0075429_100004177 3300006880 Bacteria 12366
23 Ga0111539_10103268 3300009094 Bacteria 3346
24 Ga0111539_10119489 3300009094 Bacteria 3089
25 Ga0114129_10000160 3300009147 Bacteria 72462
26 Ga0114129_10245441 3300009147 Bacteria 2406
27 Ga0105242_10398294 3300009176 Bacteria 1284
28 Ga0105249_10019896 3300009553 Bacteria 5995
29 Ga0105246_10153069 3300011119 Bacteria 1748
30 Ga0163162_10431103 3300013306 Bacteria 1450
31 Ga0157372_10203355 3300013307 Bacteria 2294
32 Ga0213876_10003119 3300021384 Bacteria 9582
33 Ga0207646_10022908 3300025922 Bacteria 5743
34 Ga0207700_10051277 3300025928 Bacteria 3079
35 Ga0207664_10085475 3300025929 Bacteria 2575
36 Ga0207706_10147678 3300025933 Bacteria 2068
37 Ga0207704_10025159 3300025938 Bacteria 3244
38 Ga0207691_10066498 3300025940 Bacteria 3261
39 Ga0207691_10084783 3300025940 Bacteria 2844
40 Ga0207661_10177968 3300025944 Bacteria 1856
41 Ga0207712_10168836 3300025961 Bacteria 1708
42 Ga0207683_10232406 3300026121 Bacteria 1682
43 Ga0307515_10169664 3300028794 Bacteria 2181
44 Ga0265338_10000830 3300028800 Bacteria 52102
45 Ga0265325_10001825 3300031241 Bacteria 14718
46 Ga0265339_10006016 3300031249 Bacteria 8019
47 Ga0265327_10009363 3300031251 Bacteria 7079
48 Ga0265327_10013285 3300031251 Bacteria 5480
49 Ga0265316_10022845 3300031344 Bacteria 5263
50 Ga0265313_10000142 3300031595 Bacteria 74294
51 Ga0307413_10062569 3300031824 Bacteria 2303
52 Ga0307410_10044142 3300031852 Bacteria 2959
53 Ga0307410_10174861 3300031852 Bacteria 1621
54 Ga0307407_10045306 3300031903 Bacteria 2485
55 Ga0307409_100316769 3300031995 Bacteria 1458
56 Ga0307416_100129529 3300032002 Bacteria 2268
57 Ga0307414_10070132 3300032004 Bacteria 2523
58 Ga0307411_10217002 3300032005 Bacteria 1481
59 Ga0307415_100209655 3300032126 Bacteria 1553
60 Ga0316574_0123642 3300035398 Bacteria 1662
61 Ga0316584_0029345 3300036712 Bacteria 4060
62 Ga0436365_0360732 3300039437 Bacteria 9389
63 Ga0436365_0532916 3300039437 Bacteria 9722
64 Ga0436365_1514215 3300039437 Bacteria 2322
65 Ga0436362_0176990 3300039453 Bacteria 3556
66 Ga0439434_0007713 3300042435 Bacteria 3154
67 Ga0466961_0041221 3300044693 Bacteria 2960
68 Ga0466961_0064134 3300044693 Bacteria 2335
69 Ga0466961_0149847 3300044693 Bacteria 1457
70 Ga0466963_0026548 3300044694 Bacteria 3705
71 Ga0466957_0058428 3300044842 Bacteria 2363
72 Ga0466967_0077185 3300045976 Bacteria 2998
73 Ga0466967_0113610 3300045976 Bacteria 2492
74 Ga0495592_0181872 3300046454 Bacteria 1431
75 Ga0495629_0094279 3300046459 Bacteria 2089
76 Ga0495653_0059608 3300046463 Bacteria 2896
77 Ga0495639_0010842 3300046475 Bacteria 3926
78 Ga0495608_0041354 3300046511 Bacteria 3085
79 Ga0495608_0059402 3300046511 Bacteria 2519
80 Ga0495618_0014330 3300046514 Bacteria 4830
81 Ga0495618_0158997 3300046514 Bacteria 1441
82 Ga0495628_0005642 3300046516 Bacteria 10954
83 Ga0495630_0016598 3300046517 Bacteria 5385
84 Ga0495630_0050013 3300046517 Bacteria 3128
85 Ga0495630_0051280 3300046517 Bacteria 3089
86 Ga0495586_0019921 3300046535 Bacteria 3573
87 Ga0495586_0033978 3300046535 Bacteria 2738
88 Ga0495667_0037801 3300046559 Bacteria 3216
89 Ga0495657_0039000 3300046675 Bacteria 3266
90 Ga0495658_0005111 3300046683 Bacteria 6449
91 Ga0495613_0000365 3300046689 Bacteria 39454
92 Ga0495604_0066895 3300047317 Bacteria 2732
93 Ga0495674_0037976 3300047319 Bacteria 4326
94 Ga0495674_0080374 3300047319 Bacteria 2798
95 Ga0495674_0102996 3300047319 Bacteria 2427
96 Ga0495674_0126370 3300047319 Bacteria 2157
97 Ga0495676_0072353 3300047321 Bacteria 2648
98 Ga0495680_0035256 3300047322 Bacteria 4031
99 Ga0495684_0029771 3300047471 Bacteria 4190
100 Ga0495684_0049016 3300047471 Bacteria 3229
101 Ga0496108_0121450 3300048911 Bacteria 2241
102 Ga0496109_0087966 3300048912 Bacteria 2870
103 Ga0496109_0089468 3300048912 Bacteria 2846
104 Ga0496109_0108580 3300048912 Bacteria 2579
105 Ga0496110_0004687 3300048913 Bacteria 10635
106 Ga0496112_0025504 3300048915 Bacteria 5676
107 Ga0496112_0027290 3300048915 Bacteria 5505
108 Ga0496114_0256753 3300048917 Bacteria 1538
109 Ga0496115_0027829 3300048918 Bacteria 4425
110 Ga0496115_0071148 3300048918 Bacteria 2821
111 Ga0501032_0046375 3300049569 Bacteria 2938
112 Ga0501034_0153390 3300049571 Bacteria 2279
113 Ga0501037_0006701 3300049573 Bacteria 8422
114 Ga0501038_0031284 3300049574 Bacteria 4704
115 Ga0501042_0090902 3300049578 Bacteria 2191
116 Ga0501043_0003545 3300049579 Bacteria 12825
117 Ga0501047_0139548 3300049581 Bacteria 2303
118 Ga0501068_0040780 3300049584 Bacteria 2788
119 Ga0501068_0100503 3300049584 Bacteria 1792
120 Ga0501070_0000942 3300049586 Bacteria 26254
121 Ga0501070_0002170 3300049586 Bacteria 17249
122 Ga0501071_0181353 3300049587 Bacteria 1578
123 Ga0501073_0003297 3300049589 Bacteria 12127
124 Ga0501073_0018693 3300049589 Bacteria 5010
125 Ga0501079_0008982 3300049741 Bacteria 7567
126 Ga0501080_0001976 3300049742 Bacteria 17683
127 Ga0501080_0045562 3300049742 Bacteria 4082
128 Ga0501080_0090094 3300049742 Bacteria 2849
129 Ga0501080_0270650 3300049742 Bacteria 1546
130 Ga0501083_0159730 3300049744 Bacteria 1475
131 Ga0501044_0006727 3300049823 Bacteria 12678
132 Ga0501044_0125131 3300049823 Bacteria 2568
133 Ga0501045_0018184 3300049824 Bacteria 4996
134 nmdc:mga05p37_6478_c1 3300050507 Bacteria 13810
135 nmdc:mga09592_132371_c1 3300050508 Bacteria 2147
136 nmdc:mga09592_3028_c1 3300050508 Bacteria 13628
137 nmdc:mga09592_3971_c1 3300050508 Bacteria 11914
138 nmdc:mga0qj67_1514_c1 3300050509 Bacteria 16300
139 nmdc:mga06r32_9877_c1 3300050510 Bacteria 8614
140 nmdc:mga08y16_138579_c1 3300050511 Bacteria 2529
141 nmdc:mga08y16_92601_c2 3300050511 Bacteria 2857
142 nmdc:mga0sz30_16940_c1 3300050516 Bacteria 2900
143 nmdc:mga0sz30_31083_c1 3300050516 Bacteria 1714
144 Ga0495612_0023998 3300053078 Bacteria 2449
145 Ga0495612_0046392 3300053078 Bacteria 1780
146 Ga0500635_0001151 3300053080 Bacteria 6336
147 Ga0495595_0007238 3300053084 Bacteria 4537
148 Ga0495595_0020146 3300053084 Bacteria 2900
149 Ga0495619_0038576 3300053085 Bacteria 3116
150 Ga0495619_0055622 3300053085 Bacteria 2621
151 Ga0500616_0003528 3300053153 Bacteria 11879
152 Ga0501084_0000240 3300054114 Bacteria 41460
153 Ga0501084_0009774 3300054114 Bacteria 7931
154 Ga0501084_0136986 3300054114 Bacteria 2061
155 2671839692 2671180195 Bacteria 9757215
156 2517763617 2517572101 Bacteria 6884336
157 2686537406 2684623035 Bacteria 8032739
158 2689996386 2687453743 Bacteria 8361025
159 2774857848 2773857922 Bacteria 9757215
160 2895881604 2895880812 Bacteria 11255272
161 8002780786 8002775197 Bacteria 10728764
162 8002789699 8002784119 Bacteria 9788632
163 8002790561 8002784119 Bacteria 9788632
164 8002792418 8002784119 Bacteria 9788632
165 8002792494 8002784119 Bacteria 9788632
166 8055161803 8055157932 Bacteria 6429399
167 Ga0070671_100113608
168 Ga0070708_100006496
169 Ga0070681_10059149
170 Ga0070707_100020347
171 Ga0070698_100185761
172 Ga0070699_100109489
173 Ga0070672_100284382
174 Ga0081455_10029225
175 Ga0081455_10095747
176 Ga0081538_10053100
177 Ga0081539_10011414
178 Ga0075363_100000488
179 Ga0075363_100087059
180 Ga0075428_100002060
181 Ga0075428_100235880
182 Ga0075430_100002513
183 Ga0075430_100004234
184 Ga0075430_100148504
185 Ga0075431_100001429
186 Ga0075431_100003675
187 Ga0075429_100001232
188 Ga0075429_100004177
189 Ga0111539_10103268
190 Ga0111539_10119489
191 Ga0114129_10000160
192 Ga0114129_10245441
193 Ga0105242_10398294
194 Ga0105249_10019896
195 Ga0105246_10153069
196 Ga0163162_10431103
197 Ga0157372_10203355
198 Ga0213876_10003119
199 Ga0207646_10022908
200 Ga0207700_10051277
201 Ga0207664_10085475
202 Ga0207706_10147678
203 Ga0207704_10025159
204 Ga0207691_10066498
205 Ga0207691_10084783
206 Ga0207661_10177968
207 Ga0207712_10168836
208 Ga0207683_10232406
209 Ga0307515_10169664
210 Ga0265338_10000830
211 Ga0265325_10001825
212 Ga0265339_10006016
213 Ga0265327_10009363
214 Ga0265327_10013285
215 Ga0265316_10022845
216 Ga0265313_10000142
217 Ga0307413_10062569
218 Ga0307410_10044142
219 Ga0307410_10174861
220 Ga0307407_10045306
221 Ga0307409_100316769
222 Ga0307416_100129529
223 Ga0307414_10070132
224 Ga0307411_10217002
225 Ga0307415_100209655
226 Ga0316574_0123642
227 Ga0316584_0029345
228 Ga0436365_0360732
229 Ga0436365_0532916
230 Ga0436365_1514215
231 Ga0436362_0176990
232 Ga0439434_0007713
233 Ga0466961_0041221
234 Ga0466961_0064134
235 Ga0466961_0149847
236 Ga0466963_0026548
237 Ga0466957_0058428
238 Ga0466967_0077185
239 Ga0466967_0113610
240 Ga0495592_0181872
241 Ga0495629_0094279
242 Ga0495653_0059608
243 Ga0495639_0010842
244 Ga0495608_0041354
245 Ga0495608_0059402
246 Ga0495618_0014330
247 Ga0495618_0158997
248 Ga0495628_0005642
249 Ga0495630_0016598
250 Ga0495630_0050013
251 Ga0495630_0051280
252 Ga0495586_0019921
253 Ga0495586_0033978
254 Ga0495667_0037801
255 Ga0495657_0039000
256 Ga0495658_0005111
257 Ga0495613_0000365
258 Ga0495604_0066895
259 Ga0495674_0037976
260 Ga0495674_0080374
261 Ga0495674_0102996
262 Ga0495674_0126370
263 Ga0495676_0072353
264 Ga0495680_0035256
265 Ga0495684_0029771
266 Ga0495684_0049016
267 Ga0496108_0121450
268 Ga0496109_0087966
269 Ga0496109_0089468
270 Ga0496109_0108580
271 Ga0496110_0004687
272 Ga0496112_0025504
273 Ga0496112_0027290
274 Ga0496114_0256753
275 Ga0496115_0027829
276 Ga0496115_0071148
277 Ga0501032_0046375
278 Ga0501034_0153390
279 Ga0501037_0006701
280 Ga0501038_0031284
281 Ga0501042_0090902
282 Ga0501043_0003545
283 Ga0501047_0139548
284 Ga0501068_0040780
285 Ga0501068_0100503
286 Ga0501070_0000942
287 Ga0501070_0002170
288 Ga0501071_0181353
289 Ga0501073_0003297
290 Ga0501073_0018693
291 Ga0501079_0008982
292 Ga0501080_0001976
293 Ga0501080_0045562
294 Ga0501080_0090094
295 Ga0501080_0270650
296 Ga0501083_0159730
297 Ga0501044_0006727
298 Ga0501044_0125131
299 Ga0501045_0018184
300 nmdc:mga05p37_6478_c1
301 nmdc:mga09592_132371_c1
302 nmdc:mga09592_3028_c1
303 nmdc:mga09592_3971_c1
304 nmdc:mga0qj67_1514_c1
305 nmdc:mga06r32_9877_c1
306 nmdc:mga08y16_138579_c1
307 nmdc:mga08y16_92601_c2
308 nmdc:mga0sz30_16940_c1
309 nmdc:mga0sz30_31083_c1
310 Ga0495612_0023998
311 Ga0495612_0046392
312 Ga0500635_0001151
313 Ga0495595_0007238
314 Ga0495595_0020146
315 Ga0495619_0038576
316 Ga0495619_0055622
317 Ga0500616_0003528
318 Ga0501084_0000240
319 Ga0501084_0009774
320 Ga0501084_0136986
321 2671839692
322 2517763617
323 2686537406
324 2689996386
325 2774857848
326 2895881604
327 8002780786
328 8002789699
329 8002790561
330 8002792418
331 8002792494
332 8055161803

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00067

p450

Cytochrome P450

202

411

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bv5-assembly2.cif.gz_B structure of cyp119 with t213a and c317h mutations 0.9074 23 400
4e2p-assembly1.cif.gz_A crystal structure of a post-tailoring hydroxylase (hmtn) involved in the himastatin biosynthesis 0.9049 32 400
5z9j-assembly2.cif.gz_B identification of the functions of unusual cytochrome p450-like monooxygenases involved in microbial secondary metablism 0.9024 32 400
5bv5-assembly2.cif.gz_B structure of cyp119 with t213a and c317h mutations 0.9015 23 400
5l94-assembly2.cif.gz_B the 2.25 a crystal structure of cyp109e1 from bacillus megaterium in complex with testosterone 0.8986 21 399
ID Description Score Start End Superfamily
af_P9WPP5_7_402_1.10.630.10 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.9123 8 399 1.10.630.10
5bv5B00 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.9074 23 400 1.10.630.10
5z9jB00 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.9024 32 400 1.10.630.10
5bv5B00 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.9015 23 400 1.10.630.10
af_P9WPP5_7_402_1.10.630.10 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.899 8 399 1.10.630.10
ID Description Score Start End GO Terms
AF-A0A1X1VCM0-F1-model_v4 Cytochrome 0.974 8 400 GO:0005506
GO:0006707
GO:0008395
GO:0020037
GO:0036199
AF-A0A2S8LVL3-F1-model_v4 deleted 0.9679 58 400
AF-A0A1E3RZP7-F1-model_v4 Cytochrome 0.9671 10 399 GO:0005506
GO:0006707
GO:0008395
GO:0020037
GO:0036199
AF-A0A1X1VCM0-F1-model_v4 Cytochrome 0.9643 8 400 GO:0005506
GO:0006707
GO:0008395
GO:0020037
GO:0036199
AF-A0A2S8LVL3-F1-model_v4 deleted 0.9597 58 400

Map