F249142

General Info

Members Datasets Scaffolds Average Seq Length
166 128 332 181

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0000376|Ga0496102_0000376_43848_44456
Length 202
Sequence MKIYINDHSVILQGKSMARIVGYIASSLDGFIATEDDSLDWLFAYDGLDLGEHDYRQFLKSIRTVVMGRGTYDFLERDGSPWAYGEQRVLVVTSRPIPNPKGALEIRGDIGSLISELRDLRDGDVWILGGGKLQMTFIERGALDEIEIYVMPELLGGGKPLFPSTGFRASLRLIEAGHLDRGCVRLHYDFDSSTEGRRLRAV

Samples

Sample ID Description Type Environment
1 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
39 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
40 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
41 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
42 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
44 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
45 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
68 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
69 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
70 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
71 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
72 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
73 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
74 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
75 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
76 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
77 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
78 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
79 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
80 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
81 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
82 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
83 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
84 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
85 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
86 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
87 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
88 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
89 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
90 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
91 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
92 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
93 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
97 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
98 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
99 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
100 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
101 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
102 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
103 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
104 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
105 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
106 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
107 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
108 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
109 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
110 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
111 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
112 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
113 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
114 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
115 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
116 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
117 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
118 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
119 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
120 2643221719 Rhizobium sp. Root274 Isolate Unclassified
121 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
122 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
123 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
124 2932401849 Devosia sp. 2618 Isolate Rhizosphere
125 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
126 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
127 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
128 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.77
Metatranscriptomes 0
Isolates 7.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.49
Nodule 1.81
Rhizoplane 4.82
Rhizosphere 61.45
Stem 0
Stem Tuber 0
Unclassified 4.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496102_0000376 3300048905 Bacteria 53516
2 JGI24740J21852_10005121 3300001979 Bacteria 5565
3 JGI24737J22298_10001522 3300001990 Bacteria 8258
4 JGI24737J22298_10001880 3300001990 Bacteria 7505
5 JGI24737J22298_10011953 3300001990 Bacteria 2836
6 JGI25162J39368_1000864 3300002737 Bacteria 19867
7 JGI25151J46595_10000087 3300003187 Bacteria 125451
8 JGI25165J46597_1000576 3300003214 Bacteria 32714
9 rootH2_10008509 3300003320 Bacteria 8722
10 rootH1_10282163 3300003323 Bacteria 1181
11 Ga0055536_1021280 3300003781 Bacteria 1973
12 Ga0065704_10077914 3300005289 Bacteria 4583
13 Ga0065704_10258159 3300005289 Bacteria 972
14 Ga0070658_10003732 3300005327 Bacteria 12454
15 Ga0070661_100000327 3300005344 Bacteria 38235
16 Ga0070667_100004666 3300005367 Bacteria 11504
17 Ga0070663_100032942 3300005455 Bacteria 3576
18 Ga0070684_100029173 3300005535 Bacteria 4673
19 Ga0068853_100080619 3300005539 Bacteria 2848
20 Ga0070665_101077008 3300005548 Bacteria 815
21 Ga0070664_100049248 3300005564 Bacteria 3563
22 Ga0068857_100765105 3300005577 Bacteria 920
23 Ga0068854_100322930 3300005578 Bacteria 1255
24 Ga0068856_100003636 3300005614 Bacteria 15492
25 Ga0068856_100253622 3300005614 Bacteria 1774
26 Ga0068856_100837867 3300005614 Bacteria 939
27 Ga0068852_100038792 3300005616 Bacteria 4006
28 Ga0068852_100338224 3300005616 Bacteria 1466
29 Ga0068852_100690858 3300005616 Bacteria 1030
30 Ga0068851_10122365 3300005834 Bacteria 1399
31 Ga0068863_100241167 3300005841 Bacteria 1745
32 Ga0075363_100013691 3300006048 Bacteria 3943
33 Ga0075366_10009303 3300006195 Bacteria 5487
34 Ga0075370_10404520 3300006353 Bacteria 819
35 Ga0075370_10522206 3300006353 Unclassified 717
36 Ga0105240_10008653 3300009093 Bacteria 14541
37 Ga0105240_10232360 3300009093 Bacteria 2142
38 Ga0105241_10002494 3300009174 Bacteria 13833
39 Ga0105241_10007566 3300009174 Bacteria 7989
40 Ga0105237_10002407 3300009545 Bacteria 23221
41 Ga0105238_10001449 3300009551 Bacteria 23800
42 Ga0105238_10780959 3300009551 Bacteria 970
43 Ga0105238_10840358 3300009551 Bacteria 935
44 Ga0105249_10003751 3300009553 Bacteria 13116
45 Ga0105249_10868861 3300009553 Bacteria 968
46 Ga0105239_10002533 3300010375 Bacteria 23221
47 Ga0157371_10000024 3300013102 Bacteria 281202
48 Ga0157370_10186574 3300013104 Bacteria 1925
49 Ga0157369_10058881 3300013105 Bacteria 4143
50 Ga0157372_10453309 3300013307 Bacteria 1495
51 Ga0182008_10022724 3300014497 Bacteria 3211
52 Ga0209437_100023 3300025233 Bacteria 614195
53 Ga0207425_1001742 3300025245 Bacteria 8533
54 Ga0209233_1000062 3300025261 Bacteria 399685
55 Ga0209233_1019603 3300025261 Bacteria 1795
56 Ga0209676_1002761 3300025292 Bacteria 11745
57 Ga0209025_1000021 3300025294 Bacteria 593083
58 Ga0209758_1003358 3300025297 Bacteria 14670
59 Ga0209257_1003952 3300025304 Bacteria 12031
60 Ga0207656_10002513 3300025321 Bacteria 6192
61 Ga0207647_10001206 3300025904 Bacteria 19863
62 Ga0207647_10022177 3300025904 Bacteria 4223
63 Ga0207705_10000246 3300025909 Bacteria 53316
64 Ga0207654_10001741 3300025911 Bacteria 11317
65 Ga0207654_10116258 3300025911 Bacteria 1672
66 Ga0207695_10003208 3300025913 Bacteria 23303
67 Ga0207695_10016016 3300025913 Bacteria 8799
68 Ga0207671_10001886 3300025914 Bacteria 23291
69 Ga0207671_10215599 3300025914 Bacteria 1503
70 Ga0207657_10198319 3300025919 Bacteria 1616
71 Ga0207649_10000773 3300025920 Bacteria 20746
72 Ga0207694_10001104 3300025924 Bacteria 23366
73 Ga0207694_10043963 3300025924 Bacteria 3448
74 Ga0207687_10642539 3300025927 Unclassified 897
75 Ga0207690_10000213 3300025932 Bacteria 44040
76 Ga0207679_10153957 3300025945 Bacteria 1875
77 Ga0207667_10000010 3300025949 Bacteria 477432
78 Ga0207667_10069748 3300025949 Bacteria 3659
79 Ga0207712_10002076 3300025961 Bacteria 13145
80 Ga0207658_10000430 3300025986 Bacteria 39640
81 Ga0207639_10001329 3300026041 Bacteria 16719
82 Ga0207678_10000625 3300026067 Bacteria 32330
83 Ga0207702_10003030 3300026078 Bacteria 15611
84 Ga0207702_10003600 3300026078 Bacteria 14077
85 Ga0207641_10097821 3300026088 Bacteria 2580
86 Ga0207674_10014247 3300026116 Bacteria 8787
87 Ga0207698_10253754 3300026142 Bacteria 1611
88 Ga0307408_100407829 3300031548 Bacteria 1169
89 Ga0307405_10022709 3300031731 Bacteria 3552
90 Ga0307405_10418433 3300031731 Bacteria 1054
91 Ga0307406_10339128 3300031901 Bacteria 1170
92 Ga0307406_10627111 3300031901 Bacteria 890
93 Ga0307414_10850586 3300032004 Unclassified 834
94 Ga0439465_0027696 3300041413 Bacteria 1796
95 Ga0451791_1083153 3300041451 Bacteria 705
96 Ga0451793_0096514 3300041452 Bacteria 846
97 Ga0451793_0849608 3300041452 Bacteria 770
98 Ga0451804_0985075 3300041463 Unclassified 600
99 Ga0451807_2049834 3300041486 Bacteria 634
100 Ga0466970_0491859 3300044765 Bacteria 706
101 Ga0495662_0082086 3300046476 Bacteria 1568
102 Ga0495643_0046450 3300046522 Bacteria 2354
103 Ga0495654_0024041 3300046530 Bacteria 3151
104 Ga0495634_0378822 3300046642 Unclassified 843
105 Ga0495657_0619765 3300046675 Unclassified 625
106 Ga0495600_0055036 3300046809 Plasmid 2599
107 Ga0495604_0014433 3300047317 Bacteria 6301
108 Ga0495681_0023441 3300047470 Bacteria 3278
109 Ga0495681_0248475 3300047470 Bacteria 703
110 Ga0495686_0023862 3300047472 Bacteria 4025
111 Ga0495686_0042589 3300047472 Bacteria 2885
112 Ga0496102_0538764 3300048905 Bacteria 1090
113 Ga0496103_0000293 3300048906 Bacteria 46560
114 Ga0496116_0001560 3300048919 Bacteria 25352
115 Ga0496117_0000695 3300048920 Bacteria 53545
116 Ga0496118_0000904 3300048921 Bacteria 46441
117 Ga0496121_0082617 3300048924 Bacteria 2539
118 Ga0496124_0000735 3300048927 Bacteria 53555
119 Ga0496125_0469975 3300048928 Bacteria 715
120 Ga0501033_0049509 3300049570 Bacteria 3119
121 Ga0501034_0063792 3300049571 Bacteria 3698
122 Ga0501034_0329248 3300049571 Bacteria 1459
123 Ga0501034_0397464 3300049571 Bacteria 1301
124 Ga0501034_0471833 3300049571 Bacteria 1171
125 Ga0501034_0864933 3300049571 Bacteria 793
126 Ga0501034_0963103 3300049571 Bacteria 738
127 Ga0501035_0081781 3300049822 Bacteria 2851
128 Ga0501035_0916579 3300049822 Bacteria 693
129 Ga0501044_0429805 3300049823 Bacteria 1230
130 Ga0501044_0856683 3300049823 Bacteria 785
131 nmdc:mga03683_57126_c1 3300050489 Bacteria 1642
132 nmdc:mga03n38_85499_c1 3300050490 Bacteria 1491
133 nmdc:mga0k408_14083_c1 3300050493 Bacteria 4398
134 nmdc:mga06z11_6388_c1 3300050494 Bacteria 4791
135 nmdc:mga07m45_350778_c1 3300050496 Bacteria 857
136 nmdc:mga07m45_464184_c1 3300050496 Unclassified 734
137 Ga0495601_0217655 3300053077 Unclassified 1247
138 Ga0500643_013569 3300053087 Bacteria 2872
139 Ga0500566_0004778 3300053094 Bacteria 8073
140 Ga0500595_016924 3300053119 Bacteria 2705
141 Ga0500608_000556 3300053122 Bacteria 13970
142 Ga0500658_0004972 3300053134 Bacteria 4953
143 Ga0500559_0000916 3300053136 Bacteria 18762
144 Ga0500568_0000001 3300053139 Bacteria 988705
145 Ga0500568_0001978 3300053139 Bacteria 12504
146 Ga0500568_0070845 3300053139 Bacteria 1335
147 Ga0500616_0017527 3300053153 Bacteria 4062
148 Ga0500622_0001342 3300053156 Bacteria 19933
149 Ga0500624_021608 3300053157 Bacteria 1041
150 Ga0500627_0000002 3300053158 Bacteria 235747
151 Ga0500634_0000025 3300053161 Bacteria 81954
152 Ga0500634_0049713 3300053161 Bacteria 2260
153 Ga0500636_0001145 3300053177 Bacteria 14219
154 Ga0500609_019890 3300053731 Bacteria 915
155 2509074619 2508501114 Bacteria 7082538
156 2644153820 2643221627 Bacteria 6761570
157 2644298291 2643221653 Bacteria 4569637
158 2644659230 2643221719 Bacteria 4568197
159 2842485728 2842482326 Bacteria 7212537
160 2893070414 2893066018 Bacteria 6158120
161 2919451301 2919450847 Bacteria 5631160
162 2932402938 2932401849 Bacteria 4262978
163 2989353723 2989349275 Bacteria 6349068
164 3000867782 3000865235 Bacteria 3106258
165 8005689630 8005688590 Bacteria 6610080
166 8046772888 8046767195 Bacteria 7547379
167 Ga0496102_0000376
168 JGI24740J21852_10005121
169 JGI24737J22298_10001522
170 JGI24737J22298_10001880
171 JGI24737J22298_10011953
172 JGI25162J39368_1000864
173 JGI25151J46595_10000087
174 JGI25165J46597_1000576
175 rootH2_10008509
176 rootH1_10282163
177 Ga0055536_1021280
178 Ga0065704_10077914
179 Ga0065704_10258159
180 Ga0070658_10003732
181 Ga0070661_100000327
182 Ga0070667_100004666
183 Ga0070663_100032942
184 Ga0070684_100029173
185 Ga0068853_100080619
186 Ga0070665_101077008
187 Ga0070664_100049248
188 Ga0068857_100765105
189 Ga0068854_100322930
190 Ga0068856_100003636
191 Ga0068856_100253622
192 Ga0068856_100837867
193 Ga0068852_100038792
194 Ga0068852_100338224
195 Ga0068852_100690858
196 Ga0068851_10122365
197 Ga0068863_100241167
198 Ga0075363_100013691
199 Ga0075366_10009303
200 Ga0075370_10404520
201 Ga0075370_10522206
202 Ga0105240_10008653
203 Ga0105240_10232360
204 Ga0105241_10002494
205 Ga0105241_10007566
206 Ga0105237_10002407
207 Ga0105238_10001449
208 Ga0105238_10780959
209 Ga0105238_10840358
210 Ga0105249_10003751
211 Ga0105249_10868861
212 Ga0105239_10002533
213 Ga0157371_10000024
214 Ga0157370_10186574
215 Ga0157369_10058881
216 Ga0157372_10453309
217 Ga0182008_10022724
218 Ga0209437_100023
219 Ga0207425_1001742
220 Ga0209233_1000062
221 Ga0209233_1019603
222 Ga0209676_1002761
223 Ga0209025_1000021
224 Ga0209758_1003358
225 Ga0209257_1003952
226 Ga0207656_10002513
227 Ga0207647_10001206
228 Ga0207647_10022177
229 Ga0207705_10000246
230 Ga0207654_10001741
231 Ga0207654_10116258
232 Ga0207695_10003208
233 Ga0207695_10016016
234 Ga0207671_10001886
235 Ga0207671_10215599
236 Ga0207657_10198319
237 Ga0207649_10000773
238 Ga0207694_10001104
239 Ga0207694_10043963
240 Ga0207687_10642539
241 Ga0207690_10000213
242 Ga0207679_10153957
243 Ga0207667_10000010
244 Ga0207667_10069748
245 Ga0207712_10002076
246 Ga0207658_10000430
247 Ga0207639_10001329
248 Ga0207678_10000625
249 Ga0207702_10003030
250 Ga0207702_10003600
251 Ga0207641_10097821
252 Ga0207674_10014247
253 Ga0207698_10253754
254 Ga0307408_100407829
255 Ga0307405_10022709
256 Ga0307405_10418433
257 Ga0307406_10339128
258 Ga0307406_10627111
259 Ga0307414_10850586
260 Ga0439465_0027696
261 Ga0451791_1083153
262 Ga0451793_0096514
263 Ga0451793_0849608
264 Ga0451804_0985075
265 Ga0451807_2049834
266 Ga0466970_0491859
267 Ga0495662_0082086
268 Ga0495643_0046450
269 Ga0495654_0024041
270 Ga0495634_0378822
271 Ga0495657_0619765
272 Ga0495600_0055036
273 Ga0495604_0014433
274 Ga0495681_0023441
275 Ga0495681_0248475
276 Ga0495686_0023862
277 Ga0495686_0042589
278 Ga0496102_0538764
279 Ga0496103_0000293
280 Ga0496116_0001560
281 Ga0496117_0000695
282 Ga0496118_0000904
283 Ga0496121_0082617
284 Ga0496124_0000735
285 Ga0496125_0469975
286 Ga0501033_0049509
287 Ga0501034_0063792
288 Ga0501034_0329248
289 Ga0501034_0397464
290 Ga0501034_0471833
291 Ga0501034_0864933
292 Ga0501034_0963103
293 Ga0501035_0081781
294 Ga0501035_0916579
295 Ga0501044_0429805
296 Ga0501044_0856683
297 nmdc:mga03683_57126_c1
298 nmdc:mga03n38_85499_c1
299 nmdc:mga0k408_14083_c1
300 nmdc:mga06z11_6388_c1
301 nmdc:mga07m45_350778_c1
302 nmdc:mga07m45_464184_c1
303 Ga0495601_0217655
304 Ga0500643_013569
305 Ga0500566_0004778
306 Ga0500595_016924
307 Ga0500608_000556
308 Ga0500658_0004972
309 Ga0500559_0000916
310 Ga0500568_0000001
311 Ga0500568_0001978
312 Ga0500568_0070845
313 Ga0500616_0017527
314 Ga0500622_0001342
315 Ga0500624_021608
316 Ga0500627_0000002
317 Ga0500634_0000025
318 Ga0500634_0049713
319 Ga0500636_0001145
320 Ga0500609_019890
321 2509074619
322 2644153820
323 2644298291
324 2644659230
325 2842485728
326 2893070414
327 2919451301
328 2932402938
329 2989353723
330 3000867782
331 8005689630
332 8046772888

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

19

185

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xw7-assembly1.cif.gz_B structure of mycobacterium smegmatis putative reductase ms0308 0.8841 2 175
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8833 1 175
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8785 1 175
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8713 1 175
2xw7-assembly1.cif.gz_B structure of mycobacterium smegmatis putative reductase ms0308 0.8651 2 175
ID Description Score Start End Superfamily
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8841 2 175 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8793 1 175 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8744 1 175 3.40.430.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8651 2 175 3.40.430.10
af_B0G189_453_564_3.30.70.240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8009 155 174 3.30.70.240
ID Description Score Start End GO Terms
AF-A0A0Q6ZRB4-F1-model_v4 Dihydrofolate reductase 0.9892 1 175 GO:0008703
GO:0009231
AF-A0A1Y6ETY7-F1-model_v4 Dihydrofolate reductase 0.9875 1 175 GO:0008703
GO:0009231
AF-A0A5J6QV35-F1-model_v4 deleted 0.9846 1 175
AF-A0A0Q6ZRB4-F1-model_v4 Dihydrofolate reductase 0.9836 1 175 GO:0008703
GO:0009231
AF-A0A1Y6ETY7-F1-model_v4 Dihydrofolate reductase 0.982 1 175 GO:0008703
GO:0009231

Map