F248999
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 166 | 121 | 332 | 120 |
Family's Representative Sequence
| Representative Sequence | 3300046459|Ga0495629_0041961|Ga0495629_0041961_499_882 |
| Length | 127 |
| Sequence | VNWANWLLVAAGAAVGAPLRFLTDRAVQARHDSVFPWGTFVVNVTGCLILGTLTGAATEGAASSHVQLLLGTGLCGALTTYSTFSYETLRLAEDGAALYAAANAVASVVVGLGAVFVGVALASALWG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 7 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 8 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 9 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 10 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 11 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 12 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 13 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 14 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 15 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 16 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 17 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 18 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 19 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 20 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 21 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 22 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 23 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 24 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 25 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 26 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 27 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 28 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 29 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 30 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 31 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 32 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 33 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 34 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 35 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 36 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 37 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 38 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 39 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 40 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 41 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 42 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 43 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 44 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 45 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 46 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 47 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 48 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 49 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 50 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 51 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 52 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 53 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 54 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 55 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 56 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 57 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 58 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 59 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 60 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 61 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 62 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 63 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 64 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 65 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 66 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 67 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 68 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 69 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 70 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 71 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 72 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 73 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 74 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 75 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 76 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 77 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 78 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 79 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 80 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 81 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 82 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 83 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 84 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 85 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 86 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 87 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 88 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 89 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 90 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 91 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 92 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 93 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 94 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 95 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 96 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 97 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 98 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 99 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 100 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 101 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 102 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 103 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 104 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 105 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 106 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 107 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 108 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 109 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 110 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 111 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 112 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 113 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 114 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 115 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 116 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 117 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 118 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 119 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 120 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 121 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.54 |
| Metatranscriptomes | 0 |
| Isolates | 14.46 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.02 |
| Nodule | 4.22 |
| Rhizoplane | 1.81 |
| Rhizosphere | 76.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.81 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495629_0041961 | 3300046459 | Bacteria | 3216 |
| 2 | rootH2_10049736 | 3300003320 | Bacteria | 3699 |
| 3 | JGI25160J50197_1059030 | 3300003354 | Bacteria | 774 |
| 4 | Ga0070683_100621469 | 3300005329 | Bacteria | 1034 |
| 5 | Ga0070685_10056111 | 3300005466 | Bacteria | 2289 |
| 6 | Ga0068858_100000237 | 3300005842 | Bacteria | 59734 |
| 7 | Ga0105247_10000090 | 3300009101 | Bacteria | 98558 |
| 8 | Ga0105247_10000448 | 3300009101 | Bacteria | 34932 |
| 9 | Ga0105248_10036071 | 3300009177 | Bacteria | 5531 |
| 10 | Ga0105246_11432025 | 3300011119 | Bacteria | 646 |
| 11 | Ga0163163_10359353 | 3300014325 | Bacteria | 1513 |
| 12 | Ga0157379_10000280 | 3300014968 | Bacteria | 40342 |
| 13 | Ga0157379_10004027 | 3300014968 | Bacteria | 12524 |
| 14 | Ga0207426_1002686 | 3300025302 | Bacteria | 10876 |
| 15 | Ga0207426_1010550 | 3300025302 | Bacteria | 3580 |
| 16 | Ga0207426_1026609 | 3300025302 | Bacteria | 1935 |
| 17 | Ga0207710_10000023 | 3300025900 | Bacteria | 329909 |
| 18 | Ga0207710_10000105 | 3300025900 | Bacteria | 105872 |
| 19 | Ga0207711_10004627 | 3300025941 | Bacteria | 11697 |
| 20 | Ga0207661_11376733 | 3300025944 | Bacteria | 648 |
| 21 | Ga0207703_10000003 | 3300026035 | Bacteria | 532213 |
| 22 | Ga0207641_12070383 | 3300026088 | Bacteria | 570 |
| 23 | Ga0207674_11047453 | 3300026116 | Bacteria | 785 |
| 24 | Ga0307509_10711283 | 3300031507 | Bacteria | 671 |
| 25 | Ga0307508_10556699 | 3300031616 | Bacteria | 745 |
| 26 | Ga0307405_11951664 | 3300031731 | Unclassified | 524 |
| 27 | Ga0307413_10750066 | 3300031824 | Bacteria | 816 |
| 28 | Ga0307518_10104924 | 3300031838 | Bacteria | 2019 |
| 29 | Ga0307406_10542223 | 3300031901 | Unclassified | 950 |
| 30 | Ga0307412_10042405 | 3300031911 | Bacteria | 2957 |
| 31 | Ga0307416_100339022 | 3300032002 | Bacteria | 1515 |
| 32 | Ga0307416_100507325 | 3300032002 | Bacteria | 1272 |
| 33 | Ga0307415_101078156 | 3300032126 | Bacteria | 751 |
| 34 | Ga0395899_0881876 | 3300037312 | Bacteria | 547 |
| 35 | Ga0395898_0006197 | 3300037466 | Bacteria | 12815 |
| 36 | Ga0395905_0329966 | 3300037471 | Bacteria | 1416 |
| 37 | Ga0395901_0139090 | 3300038443 | Bacteria | 2552 |
| 38 | Ga0395901_0324487 | 3300038443 | Bacteria | 1592 |
| 39 | Ga0451853_2368048 | 3300041512 | Bacteria | 2111 |
| 40 | Ga0439449_0011526 | 3300042007 | Bacteria | 3326 |
| 41 | Ga0466972_0160194 | 3300044658 | Bacteria | 1057 |
| 42 | Ga0466972_0444438 | 3300044658 | Bacteria | 609 |
| 43 | Ga0466965_0112822 | 3300044683 | Bacteria | 1398 |
| 44 | Ga0466966_0150626 | 3300044684 | Bacteria | 1419 |
| 45 | Ga0466961_0505451 | 3300044693 | Bacteria | 730 |
| 46 | Ga0466971_0208617 | 3300044719 | Bacteria | 923 |
| 47 | Ga0466970_0019002 | 3300044765 | Bacteria | 3560 |
| 48 | Ga0466959_0462332 | 3300045049 | Bacteria | 860 |
| 49 | Ga0466958_0179507 | 3300045836 | Bacteria | 1343 |
| 50 | Ga0466967_0510123 | 3300045976 | Bacteria | 1181 |
| 51 | Ga0495592_0057550 | 3300046454 | Bacteria | 2869 |
| 52 | Ga0495603_0060404 | 3300046455 | Bacteria | 2240 |
| 53 | Ga0495629_0009621 | 3300046459 | Bacteria | 7060 |
| 54 | Ga0495641_0332249 | 3300046461 | Bacteria | 686 |
| 55 | Ga0495651_1006644 | 3300046462 | Bacteria | 505 |
| 56 | Ga0495662_0207409 | 3300046476 | Bacteria | 966 |
| 57 | Ga0495594_0069987 | 3300046499 | Bacteria | 1950 |
| 58 | Ga0495594_0095697 | 3300046499 | Bacteria | 1668 |
| 59 | Ga0495628_0047344 | 3300046516 | Bacteria | 3412 |
| 60 | Ga0495648_0027270 | 3300046524 | Bacteria | 3827 |
| 61 | Ga0495640_0032287 | 3300046533 | Bacteria | 3730 |
| 62 | Ga0495597_0399074 | 3300046542 | Bacteria | 523 |
| 63 | Ga0495645_0059163 | 3300046543 | Bacteria | 2779 |
| 64 | Ga0495667_0164593 | 3300046559 | Bacteria | 1426 |
| 65 | Ga0495634_0010573 | 3300046642 | Bacteria | 6756 |
| 66 | Ga0495657_0007365 | 3300046675 | Bacteria | 8506 |
| 67 | Ga0495599_0648807 | 3300046678 | Bacteria | 612 |
| 68 | Ga0495623_0527491 | 3300046679 | Bacteria | 621 |
| 69 | Ga0495613_0046761 | 3300046689 | Bacteria | 3199 |
| 70 | Ga0495613_0487673 | 3300046689 | Bacteria | 831 |
| 71 | Ga0495613_0609159 | 3300046689 | Bacteria | 726 |
| 72 | Ga0495624_0181359 | 3300046690 | Bacteria | 1283 |
| 73 | Ga0495624_0533723 | 3300046690 | Bacteria | 701 |
| 74 | Ga0495604_0482108 | 3300047317 | Bacteria | 806 |
| 75 | Ga0495676_0010176 | 3300047321 | Bacteria | 8543 |
| 76 | Ga0495680_0515866 | 3300047322 | Bacteria | 809 |
| 77 | Ga0495687_002788 | 3300047443 | Bacteria | 13493 |
| 78 | Ga0495675_0174853 | 3300047444 | Bacteria | 1317 |
| 79 | Ga0495675_0445227 | 3300047444 | Bacteria | 750 |
| 80 | Ga0496100_0028809 | 3300048903 | Bacteria | 3429 |
| 81 | Ga0496103_0101952 | 3300048906 | Bacteria | 1817 |
| 82 | Ga0496104_0139873 | 3300048907 | Bacteria | 2326 |
| 83 | Ga0496116_0003202 | 3300048919 | Bacteria | 16363 |
| 84 | Ga0496117_0012288 | 3300048920 | Bacteria | 7568 |
| 85 | Ga0496118_0008795 | 3300048921 | Bacteria | 10348 |
| 86 | Ga0496119_0000445 | 3300048922 | Bacteria | 56425 |
| 87 | Ga0496119_0000763 | 3300048922 | Bacteria | 43180 |
| 88 | Ga0496120_0001776 | 3300048923 | Bacteria | 24254 |
| 89 | Ga0496120_0160085 | 3300048923 | Bacteria | 1123 |
| 90 | Ga0496121_0008353 | 3300048924 | Bacteria | 12221 |
| 91 | Ga0501031_0117071 | 3300049568 | Bacteria | 1741 |
| 92 | Ga0501032_0008122 | 3300049569 | Bacteria | 7651 |
| 93 | Ga0501032_0047946 | 3300049569 | Bacteria | 2884 |
| 94 | Ga0501032_0056700 | 3300049569 | Bacteria | 2633 |
| 95 | Ga0501033_0003583 | 3300049570 | Bacteria | 12697 |
| 96 | Ga0501033_0036283 | 3300049570 | Bacteria | 3694 |
| 97 | Ga0501033_0144519 | 3300049570 | Bacteria | 1719 |
| 98 | Ga0501033_0598294 | 3300049570 | Bacteria | 756 |
| 99 | Ga0501033_1002304 | 3300049570 | Bacteria | 558 |
| 100 | Ga0501034_0017642 | 3300049571 | Bacteria | 7319 |
| 101 | Ga0501034_0026698 | 3300049571 | Bacteria | 5875 |
| 102 | Ga0501034_0036269 | 3300049571 | Bacteria | 4995 |
| 103 | Ga0501034_0151049 | 3300049571 | Bacteria | 2298 |
| 104 | Ga0501034_0252417 | 3300049571 | Bacteria | 1708 |
| 105 | Ga0501036_0049329 | 3300049572 | Bacteria | 3565 |
| 106 | Ga0501036_0303184 | 3300049572 | Bacteria | 1336 |
| 107 | Ga0501037_0013847 | 3300049573 | Bacteria | 5943 |
| 108 | Ga0501037_0017821 | 3300049573 | Bacteria | 5228 |
| 109 | Ga0501037_0447778 | 3300049573 | Bacteria | 881 |
| 110 | Ga0501037_0529385 | 3300049573 | Bacteria | 797 |
| 111 | Ga0501039_0055111 | 3300049575 | Bacteria | 3079 |
| 112 | Ga0501039_0462874 | 3300049575 | Bacteria | 996 |
| 113 | Ga0501043_0013651 | 3300049579 | Bacteria | 6356 |
| 114 | Ga0501043_0102357 | 3300049579 | Bacteria | 2251 |
| 115 | Ga0501043_0227001 | 3300049579 | Bacteria | 1443 |
| 116 | Ga0501046_0050712 | 3300049580 | Bacteria | 3277 |
| 117 | Ga0501046_0209529 | 3300049580 | Bacteria | 1447 |
| 118 | Ga0501046_0217604 | 3300049580 | Bacteria | 1416 |
| 119 | Ga0501047_0008826 | 3300049581 | Bacteria | 9511 |
| 120 | Ga0501047_0009882 | 3300049581 | Bacteria | 9019 |
| 121 | Ga0501047_0034423 | 3300049581 | Bacteria | 4891 |
| 122 | Ga0501047_0063363 | 3300049581 | Bacteria | 3566 |
| 123 | Ga0501047_1425878 | 3300049581 | Bacteria | 508 |
| 124 | Ga0501048_0009368 | 3300049582 | Bacteria | 7353 |
| 125 | Ga0501070_0129729 | 3300049586 | Bacteria | 2083 |
| 126 | Ga0501070_0273974 | 3300049586 | Bacteria | 1378 |
| 127 | Ga0501071_1064786 | 3300049587 | Bacteria | 625 |
| 128 | Ga0501217_086130 | 3300049661 | Unclassified | 876 |
| 129 | Ga0501079_0573264 | 3300049741 | Bacteria | 888 |
| 130 | Ga0501035_0008965 | 3300049822 | Bacteria | 9305 |
| 131 | Ga0501035_0081677 | 3300049822 | Bacteria | 2852 |
| 132 | Ga0501035_0107432 | 3300049822 | Bacteria | 2446 |
| 133 | Ga0501035_0188936 | 3300049822 | Bacteria | 1771 |
| 134 | Ga0501035_0313932 | 3300049822 | Bacteria | 1318 |
| 135 | Ga0501044_0037668 | 3300049823 | Bacteria | 5053 |
| 136 | Ga0501044_0064752 | 3300049823 | Bacteria | 3730 |
| 137 | Ga0500566_0157387 | 3300053094 | Bacteria | 1188 |
| 138 | Ga0500640_267993 | 3300053095 | Bacteria | 534 |
| 139 | Ga0500660_103892 | 3300053100 | Bacteria | 1231 |
| 140 | Ga0500553_035785 | 3300053101 | Bacteria | 2459 |
| 141 | Ga0500560_199713 | 3300053107 | Bacteria | 646 |
| 142 | Ga0500614_010287 | 3300053123 | Bacteria | 2007 |
| 143 | 2508674037 | 2508501039 | Bacteria | 9978592 |
| 144 | 2616904417 | 2616644941 | Bacteria | 8510691 |
| 145 | 2676198899 | 2675902999 | Bacteria | 9438463 |
| 146 | 2676493391 | 2675903060 | Bacteria | 10051191 |
| 147 | 2689962411 | 2687453737 | Bacteria | 11203906 |
| 148 | 2689992921 | 2687453743 | Bacteria | 8361025 |
| 149 | 2774843477 | 2773857921 | Bacteria | 9435764 |
| 150 | 2816424936 | 2816332119 | Bacteria | 8120218 |
| 151 | 2837275727 | 2837268691 | Bacteria | 7850704 |
| 152 | 2863408172 | 2863404153 | Bacteria | 9672205 |
| 153 | 2873319903 | 2873314349 | Bacteria | 8512634 |
| 154 | 2884700341 | 2884693830 | Bacteria | 11273186 |
| 155 | 2895450440 | 2895442618 | Bacteria | 11027144 |
| 156 | 2912728610 | 2912723979 | Bacteria | 8557534 |
| 157 | 2935390967 | 2935390628 | Bacteria | 7043367 |
| 158 | 2947224708 | 2947224130 | Bacteria | 9938529 |
| 159 | 2990088560 | 2990088156 | Bacteria | 6657676 |
| 160 | 2997452371 | 2997451912 | Bacteria | 8492419 |
| 161 | 3006489103 | 3006486233 | Bacteria | 8157040 |
| 162 | 8002775501 | 8002775197 | Bacteria | 10728764 |
| 163 | 8002787985 | 8002784119 | Bacteria | 9788632 |
| 164 | 8048127782 | 8048127548 | Bacteria | 11053136 |
| 165 | 8055071874 | 8055066027 | Bacteria | 9479577 |
| 166 | 8055181521 | 8055172936 | Bacteria | 9305943 |
| 167 | Ga0495629_0041961 | |||
| 168 | rootH2_10049736 | |||
| 169 | JGI25160J50197_1059030 | |||
| 170 | Ga0070683_100621469 | |||
| 171 | Ga0070685_10056111 | |||
| 172 | Ga0068858_100000237 | |||
| 173 | Ga0105247_10000090 | |||
| 174 | Ga0105247_10000448 | |||
| 175 | Ga0105248_10036071 | |||
| 176 | Ga0105246_11432025 | |||
| 177 | Ga0163163_10359353 | |||
| 178 | Ga0157379_10000280 | |||
| 179 | Ga0157379_10004027 | |||
| 180 | Ga0207426_1002686 | |||
| 181 | Ga0207426_1010550 | |||
| 182 | Ga0207426_1026609 | |||
| 183 | Ga0207710_10000023 | |||
| 184 | Ga0207710_10000105 | |||
| 185 | Ga0207711_10004627 | |||
| 186 | Ga0207661_11376733 | |||
| 187 | Ga0207703_10000003 | |||
| 188 | Ga0207641_12070383 | |||
| 189 | Ga0207674_11047453 | |||
| 190 | Ga0307509_10711283 | |||
| 191 | Ga0307508_10556699 | |||
| 192 | Ga0307405_11951664 | |||
| 193 | Ga0307413_10750066 | |||
| 194 | Ga0307518_10104924 | |||
| 195 | Ga0307406_10542223 | |||
| 196 | Ga0307412_10042405 | |||
| 197 | Ga0307416_100339022 | |||
| 198 | Ga0307416_100507325 | |||
| 199 | Ga0307415_101078156 | |||
| 200 | Ga0395899_0881876 | |||
| 201 | Ga0395898_0006197 | |||
| 202 | Ga0395905_0329966 | |||
| 203 | Ga0395901_0139090 | |||
| 204 | Ga0395901_0324487 | |||
| 205 | Ga0451853_2368048 | |||
| 206 | Ga0439449_0011526 | |||
| 207 | Ga0466972_0160194 | |||
| 208 | Ga0466972_0444438 | |||
| 209 | Ga0466965_0112822 | |||
| 210 | Ga0466966_0150626 | |||
| 211 | Ga0466961_0505451 | |||
| 212 | Ga0466971_0208617 | |||
| 213 | Ga0466970_0019002 | |||
| 214 | Ga0466959_0462332 | |||
| 215 | Ga0466958_0179507 | |||
| 216 | Ga0466967_0510123 | |||
| 217 | Ga0495592_0057550 | |||
| 218 | Ga0495603_0060404 | |||
| 219 | Ga0495629_0009621 | |||
| 220 | Ga0495641_0332249 | |||
| 221 | Ga0495651_1006644 | |||
| 222 | Ga0495662_0207409 | |||
| 223 | Ga0495594_0069987 | |||
| 224 | Ga0495594_0095697 | |||
| 225 | Ga0495628_0047344 | |||
| 226 | Ga0495648_0027270 | |||
| 227 | Ga0495640_0032287 | |||
| 228 | Ga0495597_0399074 | |||
| 229 | Ga0495645_0059163 | |||
| 230 | Ga0495667_0164593 | |||
| 231 | Ga0495634_0010573 | |||
| 232 | Ga0495657_0007365 | |||
| 233 | Ga0495599_0648807 | |||
| 234 | Ga0495623_0527491 | |||
| 235 | Ga0495613_0046761 | |||
| 236 | Ga0495613_0487673 | |||
| 237 | Ga0495613_0609159 | |||
| 238 | Ga0495624_0181359 | |||
| 239 | Ga0495624_0533723 | |||
| 240 | Ga0495604_0482108 | |||
| 241 | Ga0495676_0010176 | |||
| 242 | Ga0495680_0515866 | |||
| 243 | Ga0495687_002788 | |||
| 244 | Ga0495675_0174853 | |||
| 245 | Ga0495675_0445227 | |||
| 246 | Ga0496100_0028809 | |||
| 247 | Ga0496103_0101952 | |||
| 248 | Ga0496104_0139873 | |||
| 249 | Ga0496116_0003202 | |||
| 250 | Ga0496117_0012288 | |||
| 251 | Ga0496118_0008795 | |||
| 252 | Ga0496119_0000445 | |||
| 253 | Ga0496119_0000763 | |||
| 254 | Ga0496120_0001776 | |||
| 255 | Ga0496120_0160085 | |||
| 256 | Ga0496121_0008353 | |||
| 257 | Ga0501031_0117071 | |||
| 258 | Ga0501032_0008122 | |||
| 259 | Ga0501032_0047946 | |||
| 260 | Ga0501032_0056700 | |||
| 261 | Ga0501033_0003583 | |||
| 262 | Ga0501033_0036283 | |||
| 263 | Ga0501033_0144519 | |||
| 264 | Ga0501033_0598294 | |||
| 265 | Ga0501033_1002304 | |||
| 266 | Ga0501034_0017642 | |||
| 267 | Ga0501034_0026698 | |||
| 268 | Ga0501034_0036269 | |||
| 269 | Ga0501034_0151049 | |||
| 270 | Ga0501034_0252417 | |||
| 271 | Ga0501036_0049329 | |||
| 272 | Ga0501036_0303184 | |||
| 273 | Ga0501037_0013847 | |||
| 274 | Ga0501037_0017821 | |||
| 275 | Ga0501037_0447778 | |||
| 276 | Ga0501037_0529385 | |||
| 277 | Ga0501039_0055111 | |||
| 278 | Ga0501039_0462874 | |||
| 279 | Ga0501043_0013651 | |||
| 280 | Ga0501043_0102357 | |||
| 281 | Ga0501043_0227001 | |||
| 282 | Ga0501046_0050712 | |||
| 283 | Ga0501046_0209529 | |||
| 284 | Ga0501046_0217604 | |||
| 285 | Ga0501047_0008826 | |||
| 286 | Ga0501047_0009882 | |||
| 287 | Ga0501047_0034423 | |||
| 288 | Ga0501047_0063363 | |||
| 289 | Ga0501047_1425878 | |||
| 290 | Ga0501048_0009368 | |||
| 291 | Ga0501070_0129729 | |||
| 292 | Ga0501070_0273974 | |||
| 293 | Ga0501071_1064786 | |||
| 294 | Ga0501217_086130 | |||
| 295 | Ga0501079_0573264 | |||
| 296 | Ga0501035_0008965 | |||
| 297 | Ga0501035_0081677 | |||
| 298 | Ga0501035_0107432 | |||
| 299 | Ga0501035_0188936 | |||
| 300 | Ga0501035_0313932 | |||
| 301 | Ga0501044_0037668 | |||
| 302 | Ga0501044_0064752 | |||
| 303 | Ga0500566_0157387 | |||
| 304 | Ga0500640_267993 | |||
| 305 | Ga0500660_103892 | |||
| 306 | Ga0500553_035785 | |||
| 307 | Ga0500560_199713 | |||
| 308 | Ga0500614_010287 | |||
| 309 | 2508674037 | |||
| 310 | 2616904417 | |||
| 311 | 2676198899 | |||
| 312 | 2676493391 | |||
| 313 | 2689962411 | |||
| 314 | 2689992921 | |||
| 315 | 2774843477 | |||
| 316 | 2816424936 | |||
| 317 | 2837275727 | |||
| 318 | 2863408172 | |||
| 319 | 2873319903 | |||
| 320 | 2884700341 | |||
| 321 | 2895450440 | |||
| 322 | 2912728610 | |||
| 323 | 2935390967 | |||
| 324 | 2947224708 | |||
| 325 | 2990088560 | |||
| 326 | 2997452371 | |||
| 327 | 3006489103 | |||
| 328 | 8002775501 | |||
| 329 | 8002787985 | |||
| 330 | 8048127782 | |||
| 331 | 8055071874 | |||
| 332 | 8055181521 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6bqo-assembly2.cif.gz_B-2 | structure of a dual topology fluoride channel with monobody s8 | 0.9285 | 2 | 120 |
| 6x58-assembly1.cif.gz_E | mper-fluc-ec2 bound to 10e8v4 antibody | 0.9214 | 2 | 124 |
| 6bqo-assembly1.cif.gz_A | structure of a dual topology fluoride channel with monobody s8 | 0.92 | 2 | 122 |
| 5a40-assembly2.cif.gz_C | crystal structure of a dual topology fluoride ion channel. | 0.9122 | 2 | 122 |
| 6bx4-assembly2.cif.gz_B | the crystal structure of fluoride channel fluc ec2 with monobody s9 | 0.9118 | 2 | 120 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WP61_13_121_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9674 | 5 | 115 | 1.10.287.70 |
| af_Q58918_7_116_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9449 | 6 | 115 | 1.10.287.70 |
| af_P9WP61_13_121_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9416 | 5 | 115 | 1.10.287.70 |
| af_Q58918_7_116_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9197 | 6 | 115 | 1.10.287.70 |
| af_A4I767_271_383_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9028 | 5 | 115 | 1.10.287.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0M8T2R6-F1-model_v4 | Fluoride-specific ion channel FluC | 0.9927 | 1 | 124 |
GO:0005886
GO:0046872 GO:0062054 GO:0140114 |
| AF-A0A1Z1WPE0-F1-model_v4 | Fluoride-specific ion channel FluC | 0.9925 | 2 | 124 |
GO:0005886
GO:0046872 GO:0062054 GO:0140114 |
| AF-A0A6B1P6P7-F1-model_v4 | deleted | 0.9909 | 1 | 102 |
|
| AF-A0A0K2AM74-F1-model_v4 | Fluoride-specific ion channel FluC | 0.9904 | 2 | 124 |
GO:0005886
GO:0046872 GO:0062054 GO:0140114 |
| AF-A0A848KDT3-F1-model_v4 | Fluoride-specific ion channel FluC | 0.9886 | 1 | 124 |
GO:0005886
GO:0046872 GO:0062054 GO:0140114 |