F248999

General Info

Members Datasets Scaffolds Average Seq Length
166 121 332 120

Family's Representative Sequence

Representative Sequence 3300046459|Ga0495629_0041961|Ga0495629_0041961_499_882
Length 127
Sequence VNWANWLLVAAGAAVGAPLRFLTDRAVQARHDSVFPWGTFVVNVTGCLILGTLTGAATEGAASSHVQLLLGTGLCGALTTYSTFSYETLRLAEDGAALYAAANAVASVVVGLGAVFVGVALASALWG

Samples

Sample ID Description Type Environment
1 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
6 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
7 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
8 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
9 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
10 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
11 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
12 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
13 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
14 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
15 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
17 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
18 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
19 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
20 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
21 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
22 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
23 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
24 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
25 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
26 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
27 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
28 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
29 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
30 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
31 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
32 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
33 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
34 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
35 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
36 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
37 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
38 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
39 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
40 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
41 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
42 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
43 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
44 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
45 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
46 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
47 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
48 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
49 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
50 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
51 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
52 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
53 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
54 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
55 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
56 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
57 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
58 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
59 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
60 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
61 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
62 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
63 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
64 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
65 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
66 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
67 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
68 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
69 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
70 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
71 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
72 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
73 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
74 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
75 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
87 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
88 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
89 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
90 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
92 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
93 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
94 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
95 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
96 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
97 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
98 2508501039 Frankia saprophytica CN3 Isolate Nodule
99 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
100 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
101 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
102 2687453737 Frankia sp. BMG5.36 Isolate Nodule
103 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
104 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
105 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
106 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
107 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
108 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
109 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
110 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
111 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
112 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
113 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
114 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
115 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
116 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
117 8002775197 Frankia nepalensis CN7 Isolate Nodule
118 8002784119 Frankia sp. AgB1.9 Isolate Nodule
119 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
120 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
121 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 85.54
Metatranscriptomes 0
Isolates 14.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.02
Nodule 4.22
Rhizoplane 1.81
Rhizosphere 76.51
Stem 0
Stem Tuber 0
Unclassified 1.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495629_0041961 3300046459 Bacteria 3216
2 rootH2_10049736 3300003320 Bacteria 3699
3 JGI25160J50197_1059030 3300003354 Bacteria 774
4 Ga0070683_100621469 3300005329 Bacteria 1034
5 Ga0070685_10056111 3300005466 Bacteria 2289
6 Ga0068858_100000237 3300005842 Bacteria 59734
7 Ga0105247_10000090 3300009101 Bacteria 98558
8 Ga0105247_10000448 3300009101 Bacteria 34932
9 Ga0105248_10036071 3300009177 Bacteria 5531
10 Ga0105246_11432025 3300011119 Bacteria 646
11 Ga0163163_10359353 3300014325 Bacteria 1513
12 Ga0157379_10000280 3300014968 Bacteria 40342
13 Ga0157379_10004027 3300014968 Bacteria 12524
14 Ga0207426_1002686 3300025302 Bacteria 10876
15 Ga0207426_1010550 3300025302 Bacteria 3580
16 Ga0207426_1026609 3300025302 Bacteria 1935
17 Ga0207710_10000023 3300025900 Bacteria 329909
18 Ga0207710_10000105 3300025900 Bacteria 105872
19 Ga0207711_10004627 3300025941 Bacteria 11697
20 Ga0207661_11376733 3300025944 Bacteria 648
21 Ga0207703_10000003 3300026035 Bacteria 532213
22 Ga0207641_12070383 3300026088 Bacteria 570
23 Ga0207674_11047453 3300026116 Bacteria 785
24 Ga0307509_10711283 3300031507 Bacteria 671
25 Ga0307508_10556699 3300031616 Bacteria 745
26 Ga0307405_11951664 3300031731 Unclassified 524
27 Ga0307413_10750066 3300031824 Bacteria 816
28 Ga0307518_10104924 3300031838 Bacteria 2019
29 Ga0307406_10542223 3300031901 Unclassified 950
30 Ga0307412_10042405 3300031911 Bacteria 2957
31 Ga0307416_100339022 3300032002 Bacteria 1515
32 Ga0307416_100507325 3300032002 Bacteria 1272
33 Ga0307415_101078156 3300032126 Bacteria 751
34 Ga0395899_0881876 3300037312 Bacteria 547
35 Ga0395898_0006197 3300037466 Bacteria 12815
36 Ga0395905_0329966 3300037471 Bacteria 1416
37 Ga0395901_0139090 3300038443 Bacteria 2552
38 Ga0395901_0324487 3300038443 Bacteria 1592
39 Ga0451853_2368048 3300041512 Bacteria 2111
40 Ga0439449_0011526 3300042007 Bacteria 3326
41 Ga0466972_0160194 3300044658 Bacteria 1057
42 Ga0466972_0444438 3300044658 Bacteria 609
43 Ga0466965_0112822 3300044683 Bacteria 1398
44 Ga0466966_0150626 3300044684 Bacteria 1419
45 Ga0466961_0505451 3300044693 Bacteria 730
46 Ga0466971_0208617 3300044719 Bacteria 923
47 Ga0466970_0019002 3300044765 Bacteria 3560
48 Ga0466959_0462332 3300045049 Bacteria 860
49 Ga0466958_0179507 3300045836 Bacteria 1343
50 Ga0466967_0510123 3300045976 Bacteria 1181
51 Ga0495592_0057550 3300046454 Bacteria 2869
52 Ga0495603_0060404 3300046455 Bacteria 2240
53 Ga0495629_0009621 3300046459 Bacteria 7060
54 Ga0495641_0332249 3300046461 Bacteria 686
55 Ga0495651_1006644 3300046462 Bacteria 505
56 Ga0495662_0207409 3300046476 Bacteria 966
57 Ga0495594_0069987 3300046499 Bacteria 1950
58 Ga0495594_0095697 3300046499 Bacteria 1668
59 Ga0495628_0047344 3300046516 Bacteria 3412
60 Ga0495648_0027270 3300046524 Bacteria 3827
61 Ga0495640_0032287 3300046533 Bacteria 3730
62 Ga0495597_0399074 3300046542 Bacteria 523
63 Ga0495645_0059163 3300046543 Bacteria 2779
64 Ga0495667_0164593 3300046559 Bacteria 1426
65 Ga0495634_0010573 3300046642 Bacteria 6756
66 Ga0495657_0007365 3300046675 Bacteria 8506
67 Ga0495599_0648807 3300046678 Bacteria 612
68 Ga0495623_0527491 3300046679 Bacteria 621
69 Ga0495613_0046761 3300046689 Bacteria 3199
70 Ga0495613_0487673 3300046689 Bacteria 831
71 Ga0495613_0609159 3300046689 Bacteria 726
72 Ga0495624_0181359 3300046690 Bacteria 1283
73 Ga0495624_0533723 3300046690 Bacteria 701
74 Ga0495604_0482108 3300047317 Bacteria 806
75 Ga0495676_0010176 3300047321 Bacteria 8543
76 Ga0495680_0515866 3300047322 Bacteria 809
77 Ga0495687_002788 3300047443 Bacteria 13493
78 Ga0495675_0174853 3300047444 Bacteria 1317
79 Ga0495675_0445227 3300047444 Bacteria 750
80 Ga0496100_0028809 3300048903 Bacteria 3429
81 Ga0496103_0101952 3300048906 Bacteria 1817
82 Ga0496104_0139873 3300048907 Bacteria 2326
83 Ga0496116_0003202 3300048919 Bacteria 16363
84 Ga0496117_0012288 3300048920 Bacteria 7568
85 Ga0496118_0008795 3300048921 Bacteria 10348
86 Ga0496119_0000445 3300048922 Bacteria 56425
87 Ga0496119_0000763 3300048922 Bacteria 43180
88 Ga0496120_0001776 3300048923 Bacteria 24254
89 Ga0496120_0160085 3300048923 Bacteria 1123
90 Ga0496121_0008353 3300048924 Bacteria 12221
91 Ga0501031_0117071 3300049568 Bacteria 1741
92 Ga0501032_0008122 3300049569 Bacteria 7651
93 Ga0501032_0047946 3300049569 Bacteria 2884
94 Ga0501032_0056700 3300049569 Bacteria 2633
95 Ga0501033_0003583 3300049570 Bacteria 12697
96 Ga0501033_0036283 3300049570 Bacteria 3694
97 Ga0501033_0144519 3300049570 Bacteria 1719
98 Ga0501033_0598294 3300049570 Bacteria 756
99 Ga0501033_1002304 3300049570 Bacteria 558
100 Ga0501034_0017642 3300049571 Bacteria 7319
101 Ga0501034_0026698 3300049571 Bacteria 5875
102 Ga0501034_0036269 3300049571 Bacteria 4995
103 Ga0501034_0151049 3300049571 Bacteria 2298
104 Ga0501034_0252417 3300049571 Bacteria 1708
105 Ga0501036_0049329 3300049572 Bacteria 3565
106 Ga0501036_0303184 3300049572 Bacteria 1336
107 Ga0501037_0013847 3300049573 Bacteria 5943
108 Ga0501037_0017821 3300049573 Bacteria 5228
109 Ga0501037_0447778 3300049573 Bacteria 881
110 Ga0501037_0529385 3300049573 Bacteria 797
111 Ga0501039_0055111 3300049575 Bacteria 3079
112 Ga0501039_0462874 3300049575 Bacteria 996
113 Ga0501043_0013651 3300049579 Bacteria 6356
114 Ga0501043_0102357 3300049579 Bacteria 2251
115 Ga0501043_0227001 3300049579 Bacteria 1443
116 Ga0501046_0050712 3300049580 Bacteria 3277
117 Ga0501046_0209529 3300049580 Bacteria 1447
118 Ga0501046_0217604 3300049580 Bacteria 1416
119 Ga0501047_0008826 3300049581 Bacteria 9511
120 Ga0501047_0009882 3300049581 Bacteria 9019
121 Ga0501047_0034423 3300049581 Bacteria 4891
122 Ga0501047_0063363 3300049581 Bacteria 3566
123 Ga0501047_1425878 3300049581 Bacteria 508
124 Ga0501048_0009368 3300049582 Bacteria 7353
125 Ga0501070_0129729 3300049586 Bacteria 2083
126 Ga0501070_0273974 3300049586 Bacteria 1378
127 Ga0501071_1064786 3300049587 Bacteria 625
128 Ga0501217_086130 3300049661 Unclassified 876
129 Ga0501079_0573264 3300049741 Bacteria 888
130 Ga0501035_0008965 3300049822 Bacteria 9305
131 Ga0501035_0081677 3300049822 Bacteria 2852
132 Ga0501035_0107432 3300049822 Bacteria 2446
133 Ga0501035_0188936 3300049822 Bacteria 1771
134 Ga0501035_0313932 3300049822 Bacteria 1318
135 Ga0501044_0037668 3300049823 Bacteria 5053
136 Ga0501044_0064752 3300049823 Bacteria 3730
137 Ga0500566_0157387 3300053094 Bacteria 1188
138 Ga0500640_267993 3300053095 Bacteria 534
139 Ga0500660_103892 3300053100 Bacteria 1231
140 Ga0500553_035785 3300053101 Bacteria 2459
141 Ga0500560_199713 3300053107 Bacteria 646
142 Ga0500614_010287 3300053123 Bacteria 2007
143 2508674037 2508501039 Bacteria 9978592
144 2616904417 2616644941 Bacteria 8510691
145 2676198899 2675902999 Bacteria 9438463
146 2676493391 2675903060 Bacteria 10051191
147 2689962411 2687453737 Bacteria 11203906
148 2689992921 2687453743 Bacteria 8361025
149 2774843477 2773857921 Bacteria 9435764
150 2816424936 2816332119 Bacteria 8120218
151 2837275727 2837268691 Bacteria 7850704
152 2863408172 2863404153 Bacteria 9672205
153 2873319903 2873314349 Bacteria 8512634
154 2884700341 2884693830 Bacteria 11273186
155 2895450440 2895442618 Bacteria 11027144
156 2912728610 2912723979 Bacteria 8557534
157 2935390967 2935390628 Bacteria 7043367
158 2947224708 2947224130 Bacteria 9938529
159 2990088560 2990088156 Bacteria 6657676
160 2997452371 2997451912 Bacteria 8492419
161 3006489103 3006486233 Bacteria 8157040
162 8002775501 8002775197 Bacteria 10728764
163 8002787985 8002784119 Bacteria 9788632
164 8048127782 8048127548 Bacteria 11053136
165 8055071874 8055066027 Bacteria 9479577
166 8055181521 8055172936 Bacteria 9305943
167 Ga0495629_0041961
168 rootH2_10049736
169 JGI25160J50197_1059030
170 Ga0070683_100621469
171 Ga0070685_10056111
172 Ga0068858_100000237
173 Ga0105247_10000090
174 Ga0105247_10000448
175 Ga0105248_10036071
176 Ga0105246_11432025
177 Ga0163163_10359353
178 Ga0157379_10000280
179 Ga0157379_10004027
180 Ga0207426_1002686
181 Ga0207426_1010550
182 Ga0207426_1026609
183 Ga0207710_10000023
184 Ga0207710_10000105
185 Ga0207711_10004627
186 Ga0207661_11376733
187 Ga0207703_10000003
188 Ga0207641_12070383
189 Ga0207674_11047453
190 Ga0307509_10711283
191 Ga0307508_10556699
192 Ga0307405_11951664
193 Ga0307413_10750066
194 Ga0307518_10104924
195 Ga0307406_10542223
196 Ga0307412_10042405
197 Ga0307416_100339022
198 Ga0307416_100507325
199 Ga0307415_101078156
200 Ga0395899_0881876
201 Ga0395898_0006197
202 Ga0395905_0329966
203 Ga0395901_0139090
204 Ga0395901_0324487
205 Ga0451853_2368048
206 Ga0439449_0011526
207 Ga0466972_0160194
208 Ga0466972_0444438
209 Ga0466965_0112822
210 Ga0466966_0150626
211 Ga0466961_0505451
212 Ga0466971_0208617
213 Ga0466970_0019002
214 Ga0466959_0462332
215 Ga0466958_0179507
216 Ga0466967_0510123
217 Ga0495592_0057550
218 Ga0495603_0060404
219 Ga0495629_0009621
220 Ga0495641_0332249
221 Ga0495651_1006644
222 Ga0495662_0207409
223 Ga0495594_0069987
224 Ga0495594_0095697
225 Ga0495628_0047344
226 Ga0495648_0027270
227 Ga0495640_0032287
228 Ga0495597_0399074
229 Ga0495645_0059163
230 Ga0495667_0164593
231 Ga0495634_0010573
232 Ga0495657_0007365
233 Ga0495599_0648807
234 Ga0495623_0527491
235 Ga0495613_0046761
236 Ga0495613_0487673
237 Ga0495613_0609159
238 Ga0495624_0181359
239 Ga0495624_0533723
240 Ga0495604_0482108
241 Ga0495676_0010176
242 Ga0495680_0515866
243 Ga0495687_002788
244 Ga0495675_0174853
245 Ga0495675_0445227
246 Ga0496100_0028809
247 Ga0496103_0101952
248 Ga0496104_0139873
249 Ga0496116_0003202
250 Ga0496117_0012288
251 Ga0496118_0008795
252 Ga0496119_0000445
253 Ga0496119_0000763
254 Ga0496120_0001776
255 Ga0496120_0160085
256 Ga0496121_0008353
257 Ga0501031_0117071
258 Ga0501032_0008122
259 Ga0501032_0047946
260 Ga0501032_0056700
261 Ga0501033_0003583
262 Ga0501033_0036283
263 Ga0501033_0144519
264 Ga0501033_0598294
265 Ga0501033_1002304
266 Ga0501034_0017642
267 Ga0501034_0026698
268 Ga0501034_0036269
269 Ga0501034_0151049
270 Ga0501034_0252417
271 Ga0501036_0049329
272 Ga0501036_0303184
273 Ga0501037_0013847
274 Ga0501037_0017821
275 Ga0501037_0447778
276 Ga0501037_0529385
277 Ga0501039_0055111
278 Ga0501039_0462874
279 Ga0501043_0013651
280 Ga0501043_0102357
281 Ga0501043_0227001
282 Ga0501046_0050712
283 Ga0501046_0209529
284 Ga0501046_0217604
285 Ga0501047_0008826
286 Ga0501047_0009882
287 Ga0501047_0034423
288 Ga0501047_0063363
289 Ga0501047_1425878
290 Ga0501048_0009368
291 Ga0501070_0129729
292 Ga0501070_0273974
293 Ga0501071_1064786
294 Ga0501217_086130
295 Ga0501079_0573264
296 Ga0501035_0008965
297 Ga0501035_0081677
298 Ga0501035_0107432
299 Ga0501035_0188936
300 Ga0501035_0313932
301 Ga0501044_0037668
302 Ga0501044_0064752
303 Ga0500566_0157387
304 Ga0500640_267993
305 Ga0500660_103892
306 Ga0500553_035785
307 Ga0500560_199713
308 Ga0500614_010287
309 2508674037
310 2616904417
311 2676198899
312 2676493391
313 2689962411
314 2689992921
315 2774843477
316 2816424936
317 2837275727
318 2863408172
319 2873319903
320 2884700341
321 2895450440
322 2912728610
323 2935390967
324 2947224708
325 2990088560
326 2997452371
327 3006489103
328 8002775501
329 8002787985
330 8048127782
331 8055071874
332 8055181521

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02537

CRCB

CrcB-like protein, Camphor Resistance (CrcB)

7

119

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bqo-assembly2.cif.gz_B-2 structure of a dual topology fluoride channel with monobody s8 0.9285 2 120
6x58-assembly1.cif.gz_E mper-fluc-ec2 bound to 10e8v4 antibody 0.9214 2 124
6bqo-assembly1.cif.gz_A structure of a dual topology fluoride channel with monobody s8 0.92 2 122
5a40-assembly2.cif.gz_C crystal structure of a dual topology fluoride ion channel. 0.9122 2 122
6bx4-assembly2.cif.gz_B the crystal structure of fluoride channel fluc ec2 with monobody s9 0.9118 2 120
ID Description Score Start End Superfamily
af_P9WP61_13_121_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9674 5 115 1.10.287.70
af_Q58918_7_116_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9449 6 115 1.10.287.70
af_P9WP61_13_121_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9416 5 115 1.10.287.70
af_Q58918_7_116_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9197 6 115 1.10.287.70
af_A4I767_271_383_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9028 5 115 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A0M8T2R6-F1-model_v4 Fluoride-specific ion channel FluC 0.9927 1 124 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-A0A1Z1WPE0-F1-model_v4 Fluoride-specific ion channel FluC 0.9925 2 124 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-A0A6B1P6P7-F1-model_v4 deleted 0.9909 1 102
AF-A0A0K2AM74-F1-model_v4 Fluoride-specific ion channel FluC 0.9904 2 124 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-A0A848KDT3-F1-model_v4 Fluoride-specific ion channel FluC 0.9886 1 124 GO:0005886
GO:0046872
GO:0062054
GO:0140114

Map