F248945
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 166 | 44 | 332 | 189 |
Family's Representative Sequence
| Representative Sequence | 3300044712|Ga0453684_0368214|Ga0453684_0368214_886_1518 |
| Length | 210 |
| Sequence | MTELTTELSTTNPYTRGEPMKTSIGAKTLLFPTPVLMVGTYDRDGKPNLMNAAWGGICCSQPPCVAVSLRKATYSYAAILERNAFTVGIATETRLVEADFVGMASGRNVDKFAATGLTPMRSELVDAPYAAQFPVVLECRLLQAVEIGLHTQFIGEILDVKADSQVVGEDGLPDILKIRPLIYDTAHKGYHGVGPLLGQAFSIGRALLDK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 2 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 3 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 4 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 5 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 6 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 7 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 8 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 9 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 10 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 11 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 12 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 13 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 14 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 15 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 16 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 17 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 18 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 19 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 20 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 21 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 22 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 23 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 24 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 25 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 26 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 27 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 28 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 29 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 30 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 31 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 32 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 33 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 34 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 35 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 36 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 37 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 38 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 39 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 40 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 41 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 42 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 43 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 44 | 2523533628 | Maridesulfovibrio zosterae DSM 11974 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.8 |
| Metatranscriptomes | 0.6 |
| Isolates | 0.6 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 88.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0453684_0368214 | 3300044712 | Bacteria | 1616 |
| 2 | Ga0265318_10003307 | 3300028577 | Bacteria | 8182 |
| 3 | Ga0265323_10040738 | 3300028653 | Unclassified | 1689 |
| 4 | Ga0265338_10182625 | 3300028800 | Unclassified | 1598 |
| 5 | Ga0265338_10496211 | 3300028800 | Bacteria | 860 |
| 6 | Ga0265330_10000013 | 3300031235 | Bacteria | 177129 |
| 7 | Ga0265332_10000019 | 3300031238 | Bacteria | 222130 |
| 8 | Ga0265328_10024106 | 3300031239 | Unclassified | 2301 |
| 9 | Ga0265325_10004819 | 3300031241 | Bacteria | 8446 |
| 10 | Ga0265329_10000158 | 3300031242 | Bacteria | 33656 |
| 11 | Ga0265340_10114213 | 3300031247 | Unclassified | 1246 |
| 12 | Ga0265339_10119891 | 3300031249 | Unclassified | 1353 |
| 13 | Ga0265331_10010188 | 3300031250 | Bacteria | 5215 |
| 14 | Ga0265327_10015212 | 3300031251 | Bacteria | 4983 |
| 15 | Ga0265316_10000111 | 3300031344 | Bacteria | 87754 |
| 16 | Ga0265316_10021030 | 3300031344 | Archaea | 5536 |
| 17 | Ga0265316_10504272 | 3300031344 | Archaea | 864 |
| 18 | Ga0316575_10000946 | 3300031665 | Bacteria | 8943 |
| 19 | Ga0316575_10014045 | 3300031665 | Bacteria | 3001 |
| 20 | Ga0316575_10040109 | 3300031665 | Bacteria | 1849 |
| 21 | Ga0316575_10064216 | 3300031665 | Unclassified | 1470 |
| 22 | Ga0316579_10004111 | 3300031691 | Bacteria | 5746 |
| 23 | Ga0316579_10022995 | 3300031691 | Unclassified | 2793 |
| 24 | Ga0316579_10052184 | 3300031691 | Bacteria | 1914 |
| 25 | Ga0316579_10097554 | 3300031691 | Unclassified | 1406 |
| 26 | Ga0316579_10143667 | 3300031691 | Bacteria | 1151 |
| 27 | Ga0316579_10364567 | 3300031691 | Unclassified | 699 |
| 28 | Ga0316579_10459772 | 3300031691 | Unclassified | 616 |
| 29 | Ga0265314_10000004 | 3300031711 | Bacteria | 939480 |
| 30 | Ga0265314_10224969 | 3300031711 | Unclassified | 1092 |
| 31 | Ga0265342_10000017 | 3300031712 | Bacteria | 180644 |
| 32 | Ga0316576_10005445 | 3300031727 | Bacteria | 7779 |
| 33 | Ga0316576_10018032 | 3300031727 | Bacteria | 4810 |
| 34 | Ga0316576_10053873 | 3300031727 | Bacteria | 2932 |
| 35 | Ga0316576_10070187 | 3300031727 | Bacteria | 2584 |
| 36 | Ga0316576_10142280 | 3300031727 | Unclassified | 1806 |
| 37 | Ga0316576_10158352 | 3300031727 | Bacteria | 1707 |
| 38 | Ga0316576_10159636 | 3300031727 | Bacteria | 1700 |
| 39 | Ga0316576_10334891 | 3300031727 | Bacteria | 1128 |
| 40 | Ga0316576_10559394 | 3300031727 | Unclassified | 837 |
| 41 | Ga0316578_10000049 | 3300031728 | Bacteria | 24337 |
| 42 | Ga0316578_10002260 | 3300031728 | Bacteria | 8341 |
| 43 | Ga0316578_10006390 | 3300031728 | Bacteria | 5811 |
| 44 | Ga0316578_10066372 | 3300031728 | Bacteria | 2131 |
| 45 | Ga0316578_10079079 | 3300031728 | Bacteria | 1955 |
| 46 | Ga0316578_10089936 | 3300031728 | Bacteria | 1832 |
| 47 | Ga0316577_10001561 | 3300031733 | Bacteria | 10896 |
| 48 | Ga0316577_10027338 | 3300031733 | Unclassified | 3180 |
| 49 | Ga0316577_10043690 | 3300031733 | Bacteria | 2507 |
| 50 | Ga0316577_10059197 | 3300031733 | Bacteria | 2138 |
| 51 | Ga0316577_10171665 | 3300031733 | Bacteria | 1224 |
| 52 | Ga0316577_10220641 | 3300031733 | Bacteria | 1072 |
| 53 | Ga0316577_10222885 | 3300031733 | Bacteria | 1066 |
| 54 | Ga0316577_10348863 | 3300031733 | Bacteria | 840 |
| 55 | Ga0316577_10425489 | 3300031733 | Bacteria | 754 |
| 56 | Ga0316583_10010335 | 3300032133 | Bacteria | 3365 |
| 57 | Ga0316583_10013443 | 3300032133 | Bacteria | 2954 |
| 58 | Ga0316583_10057809 | 3300032133 | Bacteria | 1361 |
| 59 | Ga0316583_10099658 | 3300032133 | Bacteria | 1013 |
| 60 | Ga0316585_10001811 | 3300032137 | Bacteria | 5722 |
| 61 | Ga0316585_10011431 | 3300032137 | Bacteria | 2618 |
| 62 | Ga0316580_10000688 | 3300032139 | Bacteria | 8095 |
| 63 | Ga0316580_10056756 | 3300032139 | Bacteria | 1204 |
| 64 | Ga0316580_10166295 | 3300032139 | Unclassified | 677 |
| 65 | Ga0316596_1088797 | 3300033541 | Bacteria | 832 |
| 66 | Ga0373928_0000570 | 3300035084 | Bacteria | 7217 |
| 67 | Ga0316574_0003915 | 3300035398 | Bacteria | 7740 |
| 68 | Ga0316574_0013819 | 3300035398 | Bacteria | 4650 |
| 69 | Ga0316574_0020373 | 3300035398 | Unclassified | 3925 |
| 70 | Ga0316574_0026371 | 3300035398 | Unclassified | 3494 |
| 71 | Ga0316574_0110052 | 3300035398 | Bacteria | 1765 |
| 72 | Ga0316582_0008080 | 3300036647 | Bacteria | 5631 |
| 73 | Ga0316582_0023452 | 3300036647 | Unclassified | 3679 |
| 74 | Ga0316582_0039883 | 3300036647 | Bacteria | 2926 |
| 75 | Ga0316582_0093407 | 3300036647 | Bacteria | 1984 |
| 76 | Ga0316582_0208113 | 3300036647 | Unclassified | 1336 |
| 77 | Ga0316582_0470671 | 3300036647 | Bacteria | 866 |
| 78 | Ga0316582_0591332 | 3300036647 | Bacteria | 764 |
| 79 | Ga0316584_0001121 | 3300036712 | Bacteria | 15698 |
| 80 | Ga0316584_0003345 | 3300036712 | Bacteria | 10395 |
| 81 | Ga0316584_0025943 | 3300036712 | Bacteria | 4302 |
| 82 | Ga0316584_0081040 | 3300036712 | Bacteria | 2431 |
| 83 | Ga0316584_0196708 | 3300036712 | Unclassified | 1489 |
| 84 | Ga0316584_0332611 | 3300036712 | Bacteria | 1093 |
| 85 | Ga0316584_0412519 | 3300036712 | Bacteria | 960 |
| 86 | Ga0316584_0424335 | 3300036712 | Bacteria | 944 |
| 87 | Ga0316584_0724498 | 3300036712 | Archaea | 680 |
| 88 | Ga0316581_0046786 | 3300037588 | Bacteria | 1323 |
| 89 | Ga0316581_0052980 | 3300037588 | Bacteria | 1243 |
| 90 | Ga0316581_0132132 | 3300037588 | Unclassified | 770 |
| 91 | Ga0400484_21386 | 3300038725 | Bacteria | 4231 |
| 92 | Ga0400484_25301 | 3300038725 | Bacteria | 1201 |
| 93 | Ga0400490_30636 | 3300038726 | Bacteria | 7918 |
| 94 | Ga0400491_00427 | 3300038727 | Bacteria | 3973 |
| 95 | Ga0400485_09819 | 3300038735 | Bacteria | 3691 |
| 96 | Ga0400485_19855 | 3300038735 | Bacteria | 23834 |
| 97 | Ga0400488_01123 | 3300038741 | Bacteria | 4391 |
| 98 | Ga0400488_41484 | 3300038741 | Bacteria | 7417 |
| 99 | Ga0400488_42198 | 3300038741 | Bacteria | 12928 |
| 100 | Ga0400486_03745 | 3300038742 | Bacteria | 15972 |
| 101 | Ga0400486_28901 | 3300038742 | Bacteria | 9902 |
| 102 | Ga0400486_28919 | 3300038742 | Bacteria | 20374 |
| 103 | Ga0400486_31955 | 3300038742 | Bacteria | 54509 |
| 104 | Ga0400489_80465 | 3300039093 | Bacteria | 4329 |
| 105 | Ga0400489_93981 | 3300039093 | Bacteria | 35729 |
| 106 | Ga0400487_03647 | 3300039110 | Bacteria | 36481 |
| 107 | Ga0400487_24413 | 3300039110 | Bacteria | 2863 |
| 108 | Ga0400487_29116 | 3300039110 | Bacteria | 2368 |
| 109 | Ga0451577_0000018 | 3300042876 | Bacteria | 516495 |
| 110 | Ga0451577_0000188 | 3300042876 | Bacteria | 131320 |
| 111 | Ga0451577_0000790 | 3300042876 | Bacteria | 47705 |
| 112 | Ga0451577_0000919 | 3300042876 | Bacteria | 43221 |
| 113 | Ga0451577_0003259 | 3300042876 | Bacteria | 18253 |
| 114 | Ga0451577_0003728 | 3300042876 | Bacteria | 16636 |
| 115 | Ga0451577_0010978 | 3300042876 | Bacteria | 8603 |
| 116 | Ga0451577_0052222 | 3300042876 | Bacteria | 3650 |
| 117 | Ga0451577_0159963 | 3300042876 | Bacteria | 2028 |
| 118 | Ga0451577_0182318 | 3300042876 | Bacteria | 1893 |
| 119 | Ga0451577_0288809 | 3300042876 | Bacteria | 1486 |
| 120 | Ga0451577_1271342 | 3300042876 | Unclassified | 655 |
| 121 | Ga0453683_0000080 | 3300044673 | Bacteria | 145649 |
| 122 | Ga0453683_0000098 | 3300044673 | Bacteria | 132195 |
| 123 | Ga0453683_0000236 | 3300044673 | Bacteria | 73105 |
| 124 | Ga0453683_0000367 | 3300044673 | Bacteria | 53968 |
| 125 | Ga0453683_0002263 | 3300044673 | Bacteria | 15206 |
| 126 | Ga0453683_0002785 | 3300044673 | Bacteria | 13298 |
| 127 | Ga0453683_0012260 | 3300044673 | Bacteria | 5624 |
| 128 | Ga0453683_0012780 | 3300044673 | Bacteria | 5495 |
| 129 | Ga0453683_0024273 | 3300044673 | Bacteria | 3860 |
| 130 | Ga0453683_0041908 | 3300044673 | Bacteria | 2875 |
| 131 | Ga0453683_0042740 | 3300044673 | Bacteria | 2845 |
| 132 | Ga0453683_0093200 | 3300044673 | Bacteria | 1889 |
| 133 | Ga0453683_0207054 | 3300044673 | Bacteria | 1246 |
| 134 | Ga0453683_0554273 | 3300044673 | Bacteria | 748 |
| 135 | Ga0453684_0000166 | 3300044712 | Bacteria | 294291 |
| 136 | Ga0453684_0000555 | 3300044712 | Bacteria | 140770 |
| 137 | Ga0453684_0000612 | 3300044712 | Bacteria | 131319 |
| 138 | Ga0453684_0001861 | 3300044712 | Bacteria | 55047 |
| 139 | Ga0453684_0002534 | 3300044712 | Bacteria | 44015 |
| 140 | Ga0453684_0003247 | 3300044712 | Bacteria | 37196 |
| 141 | Ga0453684_0007579 | 3300044712 | Bacteria | 19897 |
| 142 | Ga0453684_0013212 | 3300044712 | Bacteria | 13461 |
| 143 | Ga0453684_0020803 | 3300044712 | Bacteria | 9861 |
| 144 | Ga0453684_0035720 | 3300044712 | Bacteria | 6865 |
| 145 | Ga0453684_0053250 | 3300044712 | Archaea | 5284 |
| 146 | Ga0453684_0061857 | 3300044712 | Bacteria | 4802 |
| 147 | Ga0453684_0140784 | 3300044712 | Bacteria | 2881 |
| 148 | Ga0453684_0141355 | 3300044712 | Bacteria | 2874 |
| 149 | Ga0453684_0166479 | 3300044712 | Bacteria | 2601 |
| 150 | Ga0453684_0229946 | 3300044712 | Bacteria | 2141 |
| 151 | Ga0453684_0452305 | 3300044712 | Bacteria | 1429 |
| 152 | Ga0453684_0957268 | 3300044712 | Bacteria | 913 |
| 153 | Ga0453684_0988072 | 3300044712 | Bacteria | 896 |
| 154 | Ga0451576_0000686 | 3300045051 | Bacteria | 68943 |
| 155 | Ga0451576_0001028 | 3300045051 | Bacteria | 51476 |
| 156 | Ga0451576_0005857 | 3300045051 | Bacteria | 15264 |
| 157 | Ga0451576_0033068 | 3300045051 | Bacteria | 5499 |
| 158 | Ga0451576_0033415 | 3300045051 | Bacteria | 5467 |
| 159 | Ga0451576_0082595 | 3300045051 | Bacteria | 3342 |
| 160 | Ga0451576_0169360 | 3300045051 | Bacteria | 2280 |
| 161 | Ga0451576_0242695 | 3300045051 | Bacteria | 1882 |
| 162 | Ga0451576_0267259 | 3300045051 | Bacteria | 1788 |
| 163 | Ga0451576_1008837 | 3300045051 | Bacteria | 872 |
| 164 | Ga0496125_0004821 | 3300048928 | Bacteria | 15331 |
| 165 | Ga0501082_0777719 | 3300060353 | Bacteria | 838 |
| 166 | 2524001531 | 2523533628 | Bacteria | 4098242 |
| 167 | Ga0453684_0368214 | |||
| 168 | Ga0265318_10003307 | |||
| 169 | Ga0265323_10040738 | |||
| 170 | Ga0265338_10182625 | |||
| 171 | Ga0265338_10496211 | |||
| 172 | Ga0265330_10000013 | |||
| 173 | Ga0265332_10000019 | |||
| 174 | Ga0265328_10024106 | |||
| 175 | Ga0265325_10004819 | |||
| 176 | Ga0265329_10000158 | |||
| 177 | Ga0265340_10114213 | |||
| 178 | Ga0265339_10119891 | |||
| 179 | Ga0265331_10010188 | |||
| 180 | Ga0265327_10015212 | |||
| 181 | Ga0265316_10000111 | |||
| 182 | Ga0265316_10021030 | |||
| 183 | Ga0265316_10504272 | |||
| 184 | Ga0316575_10000946 | |||
| 185 | Ga0316575_10014045 | |||
| 186 | Ga0316575_10040109 | |||
| 187 | Ga0316575_10064216 | |||
| 188 | Ga0316579_10004111 | |||
| 189 | Ga0316579_10022995 | |||
| 190 | Ga0316579_10052184 | |||
| 191 | Ga0316579_10097554 | |||
| 192 | Ga0316579_10143667 | |||
| 193 | Ga0316579_10364567 | |||
| 194 | Ga0316579_10459772 | |||
| 195 | Ga0265314_10000004 | |||
| 196 | Ga0265314_10224969 | |||
| 197 | Ga0265342_10000017 | |||
| 198 | Ga0316576_10005445 | |||
| 199 | Ga0316576_10018032 | |||
| 200 | Ga0316576_10053873 | |||
| 201 | Ga0316576_10070187 | |||
| 202 | Ga0316576_10142280 | |||
| 203 | Ga0316576_10158352 | |||
| 204 | Ga0316576_10159636 | |||
| 205 | Ga0316576_10334891 | |||
| 206 | Ga0316576_10559394 | |||
| 207 | Ga0316578_10000049 | |||
| 208 | Ga0316578_10002260 | |||
| 209 | Ga0316578_10006390 | |||
| 210 | Ga0316578_10066372 | |||
| 211 | Ga0316578_10079079 | |||
| 212 | Ga0316578_10089936 | |||
| 213 | Ga0316577_10001561 | |||
| 214 | Ga0316577_10027338 | |||
| 215 | Ga0316577_10043690 | |||
| 216 | Ga0316577_10059197 | |||
| 217 | Ga0316577_10171665 | |||
| 218 | Ga0316577_10220641 | |||
| 219 | Ga0316577_10222885 | |||
| 220 | Ga0316577_10348863 | |||
| 221 | Ga0316577_10425489 | |||
| 222 | Ga0316583_10010335 | |||
| 223 | Ga0316583_10013443 | |||
| 224 | Ga0316583_10057809 | |||
| 225 | Ga0316583_10099658 | |||
| 226 | Ga0316585_10001811 | |||
| 227 | Ga0316585_10011431 | |||
| 228 | Ga0316580_10000688 | |||
| 229 | Ga0316580_10056756 | |||
| 230 | Ga0316580_10166295 | |||
| 231 | Ga0316596_1088797 | |||
| 232 | Ga0373928_0000570 | |||
| 233 | Ga0316574_0003915 | |||
| 234 | Ga0316574_0013819 | |||
| 235 | Ga0316574_0020373 | |||
| 236 | Ga0316574_0026371 | |||
| 237 | Ga0316574_0110052 | |||
| 238 | Ga0316582_0008080 | |||
| 239 | Ga0316582_0023452 | |||
| 240 | Ga0316582_0039883 | |||
| 241 | Ga0316582_0093407 | |||
| 242 | Ga0316582_0208113 | |||
| 243 | Ga0316582_0470671 | |||
| 244 | Ga0316582_0591332 | |||
| 245 | Ga0316584_0001121 | |||
| 246 | Ga0316584_0003345 | |||
| 247 | Ga0316584_0025943 | |||
| 248 | Ga0316584_0081040 | |||
| 249 | Ga0316584_0196708 | |||
| 250 | Ga0316584_0332611 | |||
| 251 | Ga0316584_0412519 | |||
| 252 | Ga0316584_0424335 | |||
| 253 | Ga0316584_0724498 | |||
| 254 | Ga0316581_0046786 | |||
| 255 | Ga0316581_0052980 | |||
| 256 | Ga0316581_0132132 | |||
| 257 | Ga0400484_21386 | |||
| 258 | Ga0400484_25301 | |||
| 259 | Ga0400490_30636 | |||
| 260 | Ga0400491_00427 | |||
| 261 | Ga0400485_09819 | |||
| 262 | Ga0400485_19855 | |||
| 263 | Ga0400488_01123 | |||
| 264 | Ga0400488_41484 | |||
| 265 | Ga0400488_42198 | |||
| 266 | Ga0400486_03745 | |||
| 267 | Ga0400486_28901 | |||
| 268 | Ga0400486_28919 | |||
| 269 | Ga0400486_31955 | |||
| 270 | Ga0400489_80465 | |||
| 271 | Ga0400489_93981 | |||
| 272 | Ga0400487_03647 | |||
| 273 | Ga0400487_24413 | |||
| 274 | Ga0400487_29116 | |||
| 275 | Ga0451577_0000018 | |||
| 276 | Ga0451577_0000188 | |||
| 277 | Ga0451577_0000790 | |||
| 278 | Ga0451577_0000919 | |||
| 279 | Ga0451577_0003259 | |||
| 280 | Ga0451577_0003728 | |||
| 281 | Ga0451577_0010978 | |||
| 282 | Ga0451577_0052222 | |||
| 283 | Ga0451577_0159963 | |||
| 284 | Ga0451577_0182318 | |||
| 285 | Ga0451577_0288809 | |||
| 286 | Ga0451577_1271342 | |||
| 287 | Ga0453683_0000080 | |||
| 288 | Ga0453683_0000098 | |||
| 289 | Ga0453683_0000236 | |||
| 290 | Ga0453683_0000367 | |||
| 291 | Ga0453683_0002263 | |||
| 292 | Ga0453683_0002785 | |||
| 293 | Ga0453683_0012260 | |||
| 294 | Ga0453683_0012780 | |||
| 295 | Ga0453683_0024273 | |||
| 296 | Ga0453683_0041908 | |||
| 297 | Ga0453683_0042740 | |||
| 298 | Ga0453683_0093200 | |||
| 299 | Ga0453683_0207054 | |||
| 300 | Ga0453683_0554273 | |||
| 301 | Ga0453684_0000166 | |||
| 302 | Ga0453684_0000555 | |||
| 303 | Ga0453684_0000612 | |||
| 304 | Ga0453684_0001861 | |||
| 305 | Ga0453684_0002534 | |||
| 306 | Ga0453684_0003247 | |||
| 307 | Ga0453684_0007579 | |||
| 308 | Ga0453684_0013212 | |||
| 309 | Ga0453684_0020803 | |||
| 310 | Ga0453684_0035720 | |||
| 311 | Ga0453684_0053250 | |||
| 312 | Ga0453684_0061857 | |||
| 313 | Ga0453684_0140784 | |||
| 314 | Ga0453684_0141355 | |||
| 315 | Ga0453684_0166479 | |||
| 316 | Ga0453684_0229946 | |||
| 317 | Ga0453684_0452305 | |||
| 318 | Ga0453684_0957268 | |||
| 319 | Ga0453684_0988072 | |||
| 320 | Ga0451576_0000686 | |||
| 321 | Ga0451576_0001028 | |||
| 322 | Ga0451576_0005857 | |||
| 323 | Ga0451576_0033068 | |||
| 324 | Ga0451576_0033415 | |||
| 325 | Ga0451576_0082595 | |||
| 326 | Ga0451576_0169360 | |||
| 327 | Ga0451576_0242695 | |||
| 328 | Ga0451576_0267259 | |||
| 329 | Ga0451576_1008837 | |||
| 330 | Ga0496125_0004821 | |||
| 331 | Ga0501082_0777719 | |||
| 332 | 2524001531 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2d5m-assembly1.cif.gz_A-2 | flavoredoxin of desulfovibrio vulgaris (miyazaki f) | 0.9757 | 1 | 185 |
| 2d5m-assembly1.cif.gz_A-2 | flavoredoxin of desulfovibrio vulgaris (miyazaki f) | 0.9653 | 1 | 185 |
| 3bnk-assembly1.cif.gz_A | x-ray crystal structure of flavoredoxin from methanosarcina acetivorans | 0.9569 | 1 | 186 |
| 3bnk-assembly1.cif.gz_A | x-ray crystal structure of flavoredoxin from methanosarcina acetivorans | 0.9321 | 1 | 186 |
| 3bpk-assembly1.cif.gz_B | crystal structure of nitrilotriacetate monooxygenase component b from bacillus cereus | 0.9209 | 11 | 180 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2d5mA00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.9757 | 1 | 185 | 2.30.110.10 |
| 2d5mA00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.9653 | 1 | 185 | 2.30.110.10 |
| 3bnkA00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.9569 | 1 | 186 | 2.30.110.10 |
| 3bnkA00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.9321 | 1 | 186 | 2.30.110.10 |
| 4l82C00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.9127 | 12 | 175 | 2.30.110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2I0CWU7-F1-model_v4 | Flavoredoxin | 0.9822 | 53 | 186 |
GO:0010181
|
| AF-A0A831LA64-F1-model_v4 | Flavin reductase family protein | 0.9807 | 1 | 186 |
GO:0010181
|
| AF-A0A1G0YR76-F1-model_v4 | Flavoredoxin | 0.9794 | 1 | 186 |
GO:0010181
GO:0016646 |
| AF-A0A843EYV8-F1-model_v4 | Flavin reductase family protein | 0.9779 | 1 | 186 |
GO:0010181
|
| AF-A0A1F5CR65-F1-model_v4 | Flavoredoxin | 0.9768 | 1 | 128 |
GO:0010181
|