F248917

General Info

Members Datasets Scaffolds Average Seq Length
166 133 159 222

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0067966|Ga0466969_0067966_163_858
Length 231
Sequence MGMTASSTLPGGPWQGLFHHALTLIDEIRKHGTSHPFWTFGGGTVLMLRHGHRVSKDVDIFVPDPQYLGYVNPRISDAASDITSNYEEHAGFVKLMLPDGEIDFVVSRNLTSPGYDEWTLMDRVVKVETSAEIVAKKMWHRGDRPTARDLFDLCLVIEREPESLMEAGAFLVRHRDTFLRLLNEHRAFVRPRFDDLRTLGYTPSFDYCVELADAFLRKLPGGTPEPKSRRR

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
4 2738541280 Massilia sp. GV090 Isolate Unclassified
5 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
6 2928163908 Burkholderia sp. 567 Isolate Unclassified
7 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
8 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
9 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
13 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
28 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
35 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
45 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
46 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
49 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
51 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
64 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
65 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
66 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
67 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
68 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
69 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
70 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
71 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
72 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
73 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
74 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
75 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
76 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
77 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
78 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
79 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
80 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
81 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
82 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
83 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
84 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
85 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
86 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
87 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
88 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
89 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
90 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
91 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
92 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
93 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
94 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
95 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
96 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
97 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
98 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
99 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
100 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
101 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
102 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
103 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
104 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
105 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
106 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
107 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
109 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
110 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
111 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
112 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
113 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
114 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
115 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
116 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
117 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
118 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
119 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
120 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
121 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
122 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
123 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
124 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
125 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
126 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
127 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
128 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
129 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
130 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
131 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
132 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
133 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.78
Metatranscriptomes 0
Isolates 4.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 30.12
Nodule 1.2
Rhizoplane 1.2
Rhizosphere 59.04
Stem 0
Stem Tuber 0
Unclassified 8.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10012688 3300001979 Bacteria 3169
2 JGI25154J39366_1000952 3300002738 Bacteria 11996
3 rootL2_10162108 3300003322 Bacteria 2653
4 rootH1_10019218 3300003323 Bacteria 3951
5 rootH1_10113409 3300003323 Bacteria 2325
6 Ga0055532_1003889 3300003758 Bacteria 2396
7 Ga0055527_1002004 3300003760 Bacteria 3699
8 Ga0055535_1000223 3300003761 Bacteria 60083
9 Ga0055542_1000257 3300003762 Bacteria 60083
10 Ga0055529_1000286 3300003763 Bacteria 60083
11 Ga0055526_1000005 3300003771 Bacteria 344542
12 Ga0055537_1000026 3300003773 Bacteria 105126
13 Ga0055537_1000048 3300003773 Bacteria 87588
14 Ga0055524_1000005 3300003775 Bacteria 344542
15 Ga0055534_1000002 3300003784 Bacteria 390762
16 Ga0055528_1000002 3300003790 Bacteria 368879
17 Ga0068869_100051256 3300005334 Bacteria 2994
18 Ga0070659_100001822 3300005366 Bacteria 15332
19 Ga0070678_100050763 3300005456 Bacteria 3003
20 Ga0075363_100002380 3300006048 Bacteria 7662
21 Ga0075363_100046111 3300006048 Bacteria 2312
22 Ga0075364_10001015 3300006051 Bacteria 14889
23 Ga0075432_10009572 3300006058 Bacteria 3301
24 Ga0075362_10016523 3300006177 Bacteria 3024
25 Ga0075367_10131417 3300006178 Bacteria 1547
26 Ga0075366_10068382 3300006195 Bacteria 2113
27 Ga0075370_10002299 3300006353 Bacteria 8811
28 Ga0075370_10024800 3300006353 Bacteria 3315
29 Ga0075430_100047447 3300006846 Bacteria 3627
30 Ga0075430_100186205 3300006846 Bacteria 1726
31 Ga0075434_100514767 3300006871 Bacteria 1217
32 Ga0075434_101482213 3300006871 Bacteria 688
33 Ga0079104_1024433 3300006946 Bacteria 1591
34 Ga0099794_10030303 3300007265 Bacteria 2526
35 Ga0105245_10029596 3300009098 Bacteria 4840
36 Ga0114129_10748407 3300009147 Bacteria 1251
37 Ga0105241_10872354 3300009174 Bacteria 834
38 Ga0105239_10224663 3300010375 Bacteria 2106
39 Ga0157370_10121009 3300013104 Bacteria 2444
40 Ga0157369_10248213 3300013105 Bacteria 1858
41 Ga0182008_10000035 3300014497 Bacteria 136502
42 Ga0157376_10001868 3300014969 Bacteria 14047
43 Ga0182005_1018206 3300015265 Bacteria 1941
44 Ga0213872_10000760 3300021361 Bacteria 23712
45 Ga0213872_10133942 3300021361 Bacteria 1090
46 Ga0209672_100063 3300025228 Bacteria 204903
47 Ga0209147_100077 3300025229 Bacteria 205964
48 Ga0209437_105288 3300025233 Bacteria 2206
49 Ga0209258_100105 3300025242 Bacteria 207862
50 Ga0209646_1000042 3300025246 Bacteria 343923
51 Ga0209148_1000107 3300025254 Bacteria 207862
52 Ga0209565_1000001 3300025263 Bacteria 2950419
53 Ga0209455_1000100 3300025272 Bacteria 207862
54 Ga0209673_1000001 3300025273 Bacteria 3176258
55 Ga0209675_1000001 3300025291 Bacteria 2950293
56 Ga0209564_1000001 3300025295 Bacteria 3176258
57 Ga0209564_1013912 3300025295 Bacteria 3381
58 Ga0209256_1000006 3300025299 Bacteria 1250310
59 Ga0209256_1012526 3300025299 Bacteria 3232
60 Ga0207647_10090770 3300025904 Bacteria 1822
61 Ga0207671_10616521 3300025914 Bacteria 865
62 Ga0207687_10050297 3300025927 Bacteria 2900
63 Ga0207690_10005611 3300025932 Bacteria 7416
64 Ga0207683_10069697 3300026121 Bacteria 3105
65 Ga0209281_1019630 3300027111 Bacteria 1333
66 Ga0265328_10014341 3300031239 Bacteria 3122
67 Ga0307408_100099584 3300031548 Bacteria 2212
68 Ga0307514_10200060 3300031649 Unclassified 1257
69 Ga0307412_10127681 3300031911 Bacteria 1842
70 Ga0307510_10000311 3300033180 Bacteria 44908
71 Ga0395899_0000029 3300037312 Bacteria 329371
72 Ga0395900_0000085 3300037418 Bacteria 172265
73 Ga0395898_0000086 3300037466 Bacteria 239895
74 Ga0436361_0626465 3300039447 Bacteria 1127
75 Ga0436361_0843870 3300039447 Bacteria 15818
76 Ga0451800_1459991 3300041459 Bacteria 942
77 Ga0439432_107179 3300042006 Bacteria 833
78 Ga0466969_0067966 3300044656 Bacteria 1718
79 Ga0466965_0086472 3300044683 Bacteria 1590
80 Ga0466966_0000042 3300044684 Bacteria 96648
81 Ga0466966_0007134 3300044684 Bacteria 7406
82 Ga0466966_0014079 3300044684 Bacteria 5296
83 Ga0466961_0001802 3300044693 Bacteria 13279
84 Ga0466961_0041339 3300044693 Bacteria 2955
85 Ga0466963_0008592 3300044694 Bacteria 6130
86 Ga0466970_0045494 3300044765 Bacteria 2337
87 Ga0466970_0057024 3300044765 Bacteria 2088
88 Ga0466959_0045300 3300045049 Bacteria 3239
89 Ga0451576_0011227 3300045051 Bacteria 10203
90 Ga0451576_0146491 3300045051 Bacteria 2462
91 Ga0451576_1402191 3300045051 Unclassified 727
92 Ga0466958_0007550 3300045836 Bacteria 5986
93 Ga0495617_008752 3300046452 Bacteria 3485
94 Ga0495584_0000016 3300046491 Bacteria 156560
95 Ga0495585_0203299 3300046492 Bacteria 1007
96 Ga0495607_0002862 3300046501 Bacteria 13669
97 Ga0495607_0013660 3300046501 Bacteria 5311
98 Ga0495607_0017381 3300046501 Bacteria 4619
99 Ga0495610_0000178 3300046512 Bacteria 70748
100 Ga0495648_0002429 3300046524 Bacteria 17266
101 Ga0495648_0067964 3300046524 Bacteria 2082
102 Ga0495654_0039326 3300046530 Bacteria 2362
103 Ga0495609_0000344 3300046538 Bacteria 41031
104 Ga0495597_0016215 3300046542 Bacteria 3520
105 Ga0495633_0000041 3300046558 Bacteria 176298
106 Ga0495656_0006337 3300046615 Bacteria 4147
107 Ga0495611_0001370 3300046648 Bacteria 12265
108 Ga0495625_0001244 3300046660 Bacteria 32170
109 Ga0495625_0031135 3300046660 Bacteria 3971
110 Ga0495625_0106008 3300046660 Bacteria 1925
111 Ga0495659_0000053 3300046664 Bacteria 51215
112 Ga0495661_0177689 3300046665 Bacteria 1130
113 Ga0495671_0000110 3300046692 Bacteria 73703
114 Ga0495660_0001549 3300046810 Bacteria 15463
115 Ga0495672_0000023 3300047320 Bacteria 419080
116 Ga0495672_0005128 3300047320 Bacteria 10449
117 Ga0495686_0096700 3300047472 Bacteria 1787
118 Ga0496105_0159025 3300048908 Bacteria 1855
119 Ga0496117_0141737 3300048920 Bacteria 1438
120 Ga0496118_0001889 3300048921 Bacteria 29895
121 Ga0496118_0096711 3300048921 Bacteria 2011
122 Ga0496124_0107512 3300048927 Bacteria 2250
123 Ga0501047_0336644 3300049581 Bacteria 1347
124 Ga0501071_0278169 3300049587 Bacteria 1266
125 Ga0501072_0067828 3300049588 Bacteria 2815
126 Ga0501072_0102599 3300049588 Bacteria 2274
127 Ga0501072_0605472 3300049588 Bacteria 864
128 Ga0501076_0104718 3300049592 Bacteria 2283
129 Ga0501079_0842303 3300049741 Bacteria 722
130 Ga0501080_0148089 3300049742 Bacteria 2170
131 Ga0501080_0242736 3300049742 Bacteria 1644
132 Ga0501081_0329518 3300049743 Bacteria 1123
133 Ga0501269_000186 3300049766 Bacteria 19114
134 Ga0501045_0171388 3300049824 Bacteria 1616
135 nmdc:mga03683_7415_c1 3300050489 Bacteria 3808
136 nmdc:mga03n38_48087_c1 3300050490 Bacteria 1891
137 nmdc:mga03n38_6223_c1 3300050490 Bacteria 4129
138 nmdc:mga0yw44_30725_c1 3300050492 Bacteria 3117
139 nmdc:mga0k408_14143_c1 3300050493 Bacteria 4391
140 nmdc:mga0k408_190116_c1 3300050493 Bacteria 1225
141 nmdc:mga0k408_82508_c1 3300050493 Bacteria 1884
142 nmdc:mga06z11_62521_c1 3300050494 Bacteria 1945
143 nmdc:mga07m45_13594_c1 3300050496 Bacteria 4323
144 nmdc:mga07m45_27800_c1 3300050496 Bacteria 3119
145 nmdc:mga07m45_28469_c1 3300050496 Bacteria 3084
146 nmdc:mga05p37_611356_c1 3300050507 Bacteria 1228
147 nmdc:mga0qj67_159309_c1 3300050509 Bacteria 1832
148 nmdc:mga0qj67_249927_c1 3300050509 Unclassified 1439
149 nmdc:mga0n895_816619_c1 3300050512 Bacteria 922
150 Ga0500610_0000338 3300053079 Bacteria 14149
151 Ga0500594_0002786 3300053118 Bacteria 3807
152 Ga0500568_0015396 3300053139 Bacteria 3425
153 Ga0500568_0047774 3300053139 Bacteria 1694
154 Ga0500588_0077216 3300053146 Unclassified 1106
155 Ga0500637_0000949 3300053178 Bacteria 11777
156 Ga0500570_064231 3300053724 Bacteria 1757
157 Ga0501084_0585073 3300054114 Bacteria 943
158 Ga0466962_0003976 3300061719 Bacteria 7079
159 Ga0530510_0121573 3300061734 Bacteria 1917

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025228 Ga0209672_100063 Ga0209672_10006362 185
2 3300025229 Ga0209147_100077 Ga0209147_10007762 185
3 3300025242 Ga0209258_100105 Ga0209258_10010562 185
4 3300025254 Ga0209148_1000107 Ga0209148_100010762 185
5 3300025272 Ga0209455_1000100 Ga0209455_100010062 185
6 3300006871 Ga0075434_100514767 Ga0075434_1005147672 200
7 3300009147 Ga0114129_10748407 Ga0114129_107484072 200
8 3300013104 Ga0157370_10121009 Ga0157370_101210091 200
9 3300050507 nmdc:mga05p37_611356_c1 nmdc:mga05p37_611356_c1_253_891 200
10 3300050512 nmdc:mga0n895_816619_c1 nmdc:mga0n895_816619_c1_41_679 200
11 3300050493 nmdc:mga0k408_190116_c1 nmdc:mga0k408_190116_c1_572_1201 204
12 3300007265 Ga0099794_10030303 Ga0099794_100303031 205
13 3300025295 Ga0209564_1013912 Ga0209564_10139121 205
14 3300025299 Ga0209256_1012526 Ga0209256_10125264 205
15 iso_pu_bacteria 2585428058 2587736932 212
16 3300006871 Ga0075434_101482213 Ga0075434_1014822131 214
17 3300045051 Ga0451576_0011227 Ga0451576_0011227_1815_2459 214
18 3300045051 Ga0451576_1402191 Ga0451576_1402191_65_709 214
19 3300049587 Ga0501071_0278169 Ga0501071_0278169_612_1256 214
20 3300049588 Ga0501072_0102599 Ga0501072_0102599_496_1140 214
21 3300049741 Ga0501079_0842303 Ga0501079_0842303_39_683 214
22 3300049742 Ga0501080_0148089 Ga0501080_0148089_627_1271 214
23 3300053139 Ga0500568_0047774 Ga0500568_0047774_648_1292 214
24 3300054114 Ga0501084_0585073 Ga0501084_0585073_129_773 214
25 3300045051 Ga0451576_0146491 Ga0451576_0146491_397_1044 215
26 3300049588 Ga0501072_0605472 Ga0501072_0605472_13_660 215
27 3300006048 Ga0075363_100002380 Ga0075363_1000023805 216
28 3300006048 Ga0075363_100046111 Ga0075363_1000461112 216
29 3300006051 Ga0075364_10001015 Ga0075364_100010153 216
30 3300006177 Ga0075362_10016523 Ga0075362_100165233 216
31 3300006178 Ga0075367_10131417 Ga0075367_101314172 216
32 3300006195 Ga0075366_10068382 Ga0075366_100683822 216
33 3300006353 Ga0075370_10024800 Ga0075370_100248004 216
34 3300006946 Ga0079104_1024433 Ga0079104_10244332 216
35 3300027111 Ga0209281_1019630 Ga0209281_10196302 216
36 3300050489 nmdc:mga03683_7415_c1 nmdc:mga03683_7415_c1_1977_2648 216
37 3300050490 nmdc:mga03n38_48087_c1 nmdc:mga03n38_48087_c1_903_1559 216
38 3300050490 nmdc:mga03n38_6223_c1 nmdc:mga03n38_6223_c1_622_1293 216
39 3300050492 nmdc:mga0yw44_30725_c1 nmdc:mga0yw44_30725_c1_2020_2691 216
40 3300050493 nmdc:mga0k408_14143_c1 nmdc:mga0k408_14143_c1_13_684 216
41 3300050493 nmdc:mga0k408_82508_c1 nmdc:mga0k408_82508_c1_164_820 216
42 3300050494 nmdc:mga06z11_62521_c1 nmdc:mga06z11_62521_c1_789_1460 216
43 3300050496 nmdc:mga07m45_27800_c1 nmdc:mga07m45_27800_c1_681_1337 216
44 iso_pu_bacteria 2941489479 2941492521 216
45 3300006058 Ga0075432_10009572 Ga0075432_100095723 217
46 3300044683 Ga0466965_0086472 Ga0466965_0086472_532_1188 217
47 3300044765 Ga0466970_0057024 Ga0466970_0057024_208_864 217
48 3300046660 Ga0495625_0001244 Ga0495625_0001244_28664_29338 217
49 3300048927 Ga0496124_0107512 Ga0496124_0107512_426_1100 217
50 3300049581 Ga0501047_0336644 Ga0501047_0336644_450_1103 217
51 3300053139 Ga0500568_0015396 Ga0500568_0015396_768_1421 217
52 3300006353 Ga0075370_10002299 Ga0075370_100022999 218
53 3300006846 Ga0075430_100186205 Ga0075430_1001862052 218
54 3300021361 Ga0213872_10000760 Ga0213872_1000076024 218
55 3300031911 Ga0307412_10127681 Ga0307412_101276812 218
56 3300039447 Ga0436361_0843870 Ga0436361_0843870_1709_2383 218
57 3300044684 Ga0466966_0007134 Ga0466966_0007134_3042_3701 218
58 3300044693 Ga0466961_0041339 Ga0466961_0041339_1659_2318 218
59 3300044765 Ga0466970_0045494 Ga0466970_0045494_349_1008 218
60 3300049588 Ga0501072_0067828 Ga0501072_0067828_509_1165 218
61 3300049592 Ga0501076_0104718 Ga0501076_0104718_824_1480 218
62 3300049742 Ga0501080_0242736 Ga0501080_0242736_747_1403 218
63 3300049743 Ga0501081_0329518 Ga0501081_0329518_414_1070 218
64 3300049824 Ga0501045_0171388 Ga0501045_0171388_454_1110 218
65 3300050496 nmdc:mga07m45_13594_c1 nmdc:mga07m45_13594_c1_3441_4118 218
66 3300050509 nmdc:mga0qj67_159309_c1 nmdc:mga0qj67_159309_c1_345_1004 218
67 3300061734 Ga0530510_0121573 Ga0530510_0121573_534_1190 218
68 3300005334 Ga0068869_100051256 Ga0068869_1000512563 219
69 3300009098 Ga0105245_10029596 Ga0105245_100295963 219
70 3300014969 Ga0157376_10001868 Ga0157376_1000186817 219
71 3300021361 Ga0213872_10133942 Ga0213872_101339422 219
72 3300025927 Ga0207687_10050297 Ga0207687_100502973 219
73 3300039447 Ga0436361_0626465 Ga0436361_0626465_142_801 219
74 3300041459 Ga0451800_1459991 Ga0451800_1459991_114_773 219
75 3300046524 Ga0495648_0067964 Ga0495648_0067964_1303_2025 219
76 3300053118 Ga0500594_0002786 Ga0500594_0002786_1420_2124 219
77 iso_pu_bacteria 2501025502 2501082406 219
78 iso_pu_bacteria 2510917013 2511086251 219
79 3300009174 Ga0105241_10872354 Ga0105241_108723541 220
80 3300014497 Ga0182008_10000035 Ga0182008_10000035104 220
81 3300031548 Ga0307408_100099584 Ga0307408_1000995843 220
82 3300049766 Ga0501269_000186 Ga0501269_000186_8190_8870 220
83 3300003323 rootH1_10113409 rootH1_101134093 221
84 3300037312 Ga0395899_0000029 Ga0395899_0000029_232993_233658 221
85 3300037418 Ga0395900_0000085 Ga0395900_0000085_95714_96379 221
86 3300037466 Ga0395898_0000086 Ga0395898_0000086_95714_96379 221
87 3300044684 Ga0466966_0000042 Ga0466966_0000042_95041_95706 221
88 3300044693 Ga0466961_0001802 Ga0466961_0001802_6219_6884 221
89 3300044694 Ga0466963_0008592 Ga0466963_0008592_1181_1852 221
90 3300045049 Ga0466959_0045300 Ga0466959_0045300_2489_3160 221
91 3300045836 Ga0466958_0007550 Ga0466958_0007550_5056_5727 221
92 3300046452 Ga0495617_008752 Ga0495617_008752_1647_2330 221
93 3300046492 Ga0495585_0203299 Ga0495585_0203299_260_943 221
94 3300046501 Ga0495607_0002862 Ga0495607_0002862_6550_7233 221
95 3300046660 Ga0495625_0031135 Ga0495625_0031135_1432_2115 221
96 3300046660 Ga0495625_0106008 Ga0495625_0106008_403_1107 221
97 3300047320 Ga0495672_0005128 Ga0495672_0005128_5290_5973 221
98 3300053079 Ga0500610_0000338 Ga0500610_0000338_10238_10903 221
99 3300061719 Ga0466962_0003976 Ga0466962_0003976_5994_6659 221
100 3300003322 rootL2_10162108 rootL2_101621084 222
101 3300003323 rootH1_10019218 rootH1_100192184 222
102 3300025233 Ga0209437_105288 Ga0209437_1052883 222
103 3300031239 Ga0265328_10014341 Ga0265328_100143414 222
104 3300033180 Ga0307510_10000311 Ga0307510_100003115 222
105 3300046512 Ga0495610_0000178 Ga0495610_0000178_791_1486 222
106 3300046530 Ga0495654_0039326 Ga0495654_0039326_615_1319 222
107 3300046542 Ga0495597_0016215 Ga0495597_0016215_1748_2443 222
108 3300046664 Ga0495659_0000053 Ga0495659_0000053_30735_31430 222
109 3300046692 Ga0495671_0000110 Ga0495671_0000110_37503_38207 222
110 3300047320 Ga0495672_0000023 Ga0495672_0000023_390305_391000 222
111 3300047472 Ga0495686_0096700 Ga0495686_0096700_972_1688 222
112 iso_pu_bacteria 2738541280 2738737853 222
113 3300002738 JGI25154J39366_1000952 JGI25154J39366_10009529 223
114 3300025246 Ga0209646_1000042 Ga0209646_1000042145 223
115 3300025914 Ga0207671_10616521 Ga0207671_106165212 223
116 3300044684 Ga0466966_0014079 Ga0466966_0014079_872_1549 223
117 3300046491 Ga0495584_0000016 Ga0495584_0000016_119884_120591 223
118 3300046501 Ga0495607_0013660 Ga0495607_0013660_1478_2185 223
119 3300046615 Ga0495656_0006337 Ga0495656_0006337_2903_3610 223
120 3300046648 Ga0495611_0001370 Ga0495611_0001370_5113_5820 223
121 3300046665 Ga0495661_0177689 Ga0495661_0177689_274_981 223
122 3300006846 Ga0075430_100047447 Ga0075430_1000474475 224
123 3300046810 Ga0495660_0001549 Ga0495660_0001549_13707_14381 224
124 3300050509 nmdc:mga0qj67_249927_c1 nmdc:mga0qj67_249927_c1_67_741 224
125 3300053178 Ga0500637_0000949 Ga0500637_0000949_7200_7874 224
126 iso_pu_bacteria 2901300506 2901313305 224
127 3300003771 Ga0055526_1000005 Ga0055526_1000005141 225
128 3300003773 Ga0055537_1000026 Ga0055537_100002667 225
129 3300003773 Ga0055537_1000048 Ga0055537_100004813 225
130 3300003775 Ga0055524_1000005 Ga0055524_1000005142 225
131 3300003784 Ga0055534_1000002 Ga0055534_1000002187 225
132 3300003790 Ga0055528_1000002 Ga0055528_1000002187 225
133 3300005456 Ga0070678_100050763 Ga0070678_1000507634 225
134 3300025263 Ga0209565_1000001 Ga0209565_1000001638 225
135 3300025273 Ga0209673_1000001 Ga0209673_1000001638 225
136 3300025291 Ga0209675_1000001 Ga0209675_10000011894 225
137 3300025295 Ga0209564_1000001 Ga0209564_10000012056 225
138 3300025299 Ga0209256_1000006 Ga0209256_1000006492 225
139 3300026121 Ga0207683_10069697 Ga0207683_100696974 225
140 3300042006 Ga0439432_107179 Ga0439432_107179_82_780 225
141 3300053146 Ga0500588_0077216 Ga0500588_0077216_23_700 225
142 iso_pu_bacteria 2928163908 2928170432 225
143 3300050496 nmdc:mga07m45_28469_c1 nmdc:mga07m45_28469_c1_2186_2881 226
144 3300005366 Ga0070659_100001822 Ga0070659_1000018222 227
145 3300025932 Ga0207690_10005611 Ga0207690_100056119 227
146 3300031649 Ga0307514_10200060 Ga0307514_102000601 227
147 3300046538 Ga0495609_0000344 Ga0495609_0000344_12907_13653 227
148 3300048921 Ga0496118_0001889 Ga0496118_0001889_24150_24839 227
149 3300053724 Ga0500570_064231 Ga0500570_064231_975_1679 227
150 3300046501 Ga0495607_0017381 Ga0495607_0017381_921_1679 228
151 3300046524 Ga0495648_0002429 Ga0495648_0002429_3764_4513 228
152 3300046558 Ga0495633_0000041 Ga0495633_0000041_66654_67403 228
153 3300001979 JGI24740J21852_10012688 JGI24740J21852_100126884 229
154 3300003758 Ga0055532_1003889 Ga0055532_10038891 229
155 3300003760 Ga0055527_1002004 Ga0055527_10020043 229
156 3300003761 Ga0055535_1000223 Ga0055535_10002232 229
157 3300003762 Ga0055542_1000257 Ga0055542_10002572 229
158 3300003763 Ga0055529_1000286 Ga0055529_10002862 229
159 3300010375 Ga0105239_10224663 Ga0105239_102246633 229
160 3300013105 Ga0157369_10248213 Ga0157369_102482132 229
161 3300015265 Ga0182005_1018206 Ga0182005_10182063 229
162 3300025904 Ga0207647_10090770 Ga0207647_100907701 229
163 3300044656 Ga0466969_0067966 Ga0466969_0067966_163_858 229
164 3300048908 Ga0496105_0159025 Ga0496105_0159025_131_826 229
165 3300048920 Ga0496117_0141737 Ga0496117_0141737_523_1218 229
166 3300048921 Ga0496118_0096711 Ga0496118_0096711_291_986 229

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08843

AbiEii

Nucleotidyl transferase AbiEii toxin, Type IV TA system

24

224

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i7r-assembly1.cif.gz_B conserved domain protein 0.6422 52 109
3g12-assembly1.cif.gz_A crystal structure of a putative lactoylglutathione lyase from bdellovibrio bacteriovorus 0.6316 52 108
1o22-assembly1.cif.gz_A-2 crystal structure of an orphan protein (tm0875) from thermotoga maritima at 2.00 a resolution 0.5956 84 104
3g12-assembly1.cif.gz_B crystal structure of a putative lactoylglutathione lyase from bdellovibrio bacteriovorus 0.5944 52 108
4hx0-assembly1.cif.gz_A crystal structure of a putative nucleotidyltransferase (tm1012) from thermotoga maritima at 1.87 a resolution 0.5936 13 127
ID Description Score Start End Superfamily
3oumA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.5815 54 115 3.10.180.10
3wfqH01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.5512 22 109 3.30.460.10
2ewrA00 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.5041 14 183 3.30.460.40
2ewrA00 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.4913 14 183 3.30.460.40
af_Q12028_1_632_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.4811 129 214 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A5C7UKK3-F1-model_v4 Nucleotidyl transferase AbiEii/AbiGii toxin family protein 0.9838 45 215
AF-A0A6N1BDY0-F1-model_v4 deleted 0.9789 1 217
AF-A0A484Y1L7-F1-model_v4 Uncharacterized protein 0.9785 105 217
AF-A0A0D0GP41-F1-model_v4 Nucleotidyl transferase AbiEii/AbiGii toxin family protein 0.9757 7 165
AF-A0A316IEX4-F1-model_v4 Nucleotidyltransferase AbiEii toxin of type IV toxin-antitoxin system 0.967 45 218 GO:0016740

Feature Viewer

pLDDT pTM Quality
91.8 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map