F248824

General Info

Members Datasets Scaffolds Average Seq Length
166 159 72 240

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0383730|Ga0395898_0383730_296_1024
Length 237
Sequence MMTRVALVTGGTRGIGAAVSRALKAAGCSVAANYAGNDKAAEAFSAETGIPTYRWDIGDFNACAAGVEAVEAALGPVDILVNNAGIVRDAALHKMMPAQWNAVVRTNLDGLFNMCRQVIEGMRARKFGRIITISSINGQKGQFGQTNYSAAKFTKALALETARLGITVNSICPGYIHTEMLDAVPPDVMEKSILPQIPVGRLGKPDEIARAVVFLAADEAGFITGSTLSVNGGQYMT

Samples

Sample ID Description Type Environment
1 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
2 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
3 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
4 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
5 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
6 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
7 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
8 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
9 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
10 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
11 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
12 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
13 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
14 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
15 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
16 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
17 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
18 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
19 2643221568 Rhizobium sp. Root564 Isolate Unclassified
20 2643221582 Rhizobium sp. Root651 Isolate Unclassified
21 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
22 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
23 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
24 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
25 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
26 2643221718 Rhizobium sp. Root268 Isolate Unclassified
27 2643221719 Rhizobium sp. Root274 Isolate Unclassified
28 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
29 2738543024 Aminobacter sp. AP02 Isolate Unclassified
30 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
31 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
32 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
33 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
34 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
35 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
36 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
37 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
38 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
39 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
40 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
41 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
42 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
43 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
44 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
45 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
46 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
47 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
48 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
49 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
50 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
51 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
52 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
53 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
54 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
55 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
56 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
57 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
58 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
59 2922368715
60 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
61 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
62 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
63 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
64 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
65 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
66 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
67 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
68 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
69 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
70 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
71 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
72 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
73 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
74 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
75 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
76 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
77 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
78 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
79 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
80 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
81 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
82 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
83 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
84 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
85 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
86 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
87 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
88 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
89 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
90 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
91 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
92 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
93 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
94 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
95 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
96 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
97 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
98 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
99 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
100 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
101 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
102 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
103 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
104 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
137 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
138 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
139 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
140 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
148 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
154 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
155 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
156 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
157 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
158 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
159 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 43.64
Metatranscriptomes 0
Isolates 56.36

Biome Distribution

Category Percentage (%)
Aerial Root 0.6
Bulb 0
Endosphere 0
Nodule 28.92
Rhizoplane 3.01
Rhizosphere 49.4
Stem 0
Stem Tuber 0.6
Unclassified 17.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10016702 3300003203 Bacteria 3054
2 Ga0065714_10089705 3300005288 Bacteria 1970
3 Ga0065712_10070612 3300005290 Bacteria 5851
4 Ga0070683_100014019 3300005329 Bacteria 6999
5 Ga0070670_100328879 3300005331 Bacteria 1340
6 Ga0070689_100116807 3300005340 Bacteria 2127
7 Ga0070713_100040845 3300005436 Bacteria 3774
8 Ga0070681_10034110 3300005458 Bacteria 5111
9 Ga0070679_100040420 3300005530 Bacteria 4640
10 Ga0068856_100489447 3300005614 Bacteria 1251
11 Ga0068864_100004288 3300005618 Bacteria 11725
12 Ga0068861_100873370 3300005719 Bacteria 850
13 Ga0068858_100003889 3300005842 Bacteria 14750
14 Ga0081539_10000522 3300005985 Bacteria 79973
15 Ga0081539_10112048 3300005985 Bacteria 1371
16 Ga0075431_100003429 3300006847 Bacteria 15377
17 Ga0105240_10215472 3300009093 Bacteria 2241
18 Ga0105245_10160526 3300009098 Bacteria 2133
19 Ga0105247_10002673 3300009101 Bacteria 11982
20 Ga0114129_10710996 3300009147 Bacteria 1290
21 Ga0105243_10675020 3300009148 Bacteria 1004
22 Ga0105248_10004534 3300009177 Bacteria 15368
23 Ga0105238_10348775 3300009551 Bacteria 1469
24 Ga0105249_10831978 3300009553 Bacteria 988
25 Ga0163163_10004574 3300014325 Bacteria 11810
26 Ga0207695_10023600 3300025913 Bacteria 6942
27 Ga0207695_10140947 3300025913 Bacteria 2359
28 Ga0207695_10286222 3300025913 Bacteria 1541
29 Ga0207681_10252410 3300025923 Bacteria 1378
30 Ga0207694_10005969 3300025924 Bacteria 9333
31 Ga0207687_10027678 3300025927 Bacteria 3805
32 Ga0207700_10012013 3300025928 Bacteria 5558
33 Ga0207670_10095502 3300025936 Bacteria 2111
34 Ga0207691_10602654 3300025940 Bacteria 930
35 Ga0207711_10012888 3300025941 Bacteria 6946
36 Ga0207689_10014351 3300025942 Bacteria 6740
37 Ga0207661_10009867 3300025944 Bacteria 6859
38 Ga0207679_10086888 3300025945 Bacteria 2407
39 Ga0207703_10011391 3300026035 Bacteria 6918
40 Ga0207703_10521046 3300026035 Bacteria 1118
41 Ga0207702_10448821 3300026078 Bacteria 1251
42 Ga0207641_10079732 3300026088 Bacteria 2839
43 Ga0207676_10008419 3300026095 Bacteria 7332
44 Ga0307408_100000443 3300031548 Bacteria 36595
45 Ga0307516_10091638 3300031730 Bacteria 2867
46 Ga0307416_100533519 3300032002 Bacteria 1244
47 Ga0316574_0334928 3300035398 Bacteria 959
48 Ga0395899_0032562 3300037312 Bacteria 3916
49 Ga0395899_0044621 3300037312 Bacteria 3303
50 Ga0395898_0383730 3300037466 Bacteria 1340
51 Ga0395901_0015459 3300038443 Bacteria 7771
52 Ga0400483_282015 3300039062 Bacteria 7947
53 Ga0400487_43381 3300039110 Bacteria 1564
54 Ga0436360_1193094 3300039438 Bacteria 3988
55 Ga0436361_0517945 3300039447 Bacteria 984
56 Ga0466970_0014982 3300044765 Bacteria 3987
57 Ga0451576_0021714 3300045051 Bacteria 6971
58 Ga0451576_0091844 3300045051 Bacteria 3158
59 Ga0495686_0000096 3300047472 Bacteria 184611
60 Ga0496104_0047611 3300048907 Bacteria 4041
61 Ga0496108_0013249 3300048911 Bacteria 6719
62 Ga0496112_0046212 3300048915 Bacteria 4269
63 Ga0496113_0005103 3300048916 Bacteria 8157
64 Ga0496121_0088458 3300048924 Bacteria 2428
65 Ga0496126_0562307 3300048929 Bacteria 903
66 Ga0501034_0158550 3300049571 Bacteria 2235
67 Ga0501034_0460000 3300049571 Bacteria 1189
68 Ga0501042_0151765 3300049578 Bacteria 1671
69 Ga0501046_0125060 3300049580 Bacteria 1954
70 Ga0501048_0361904 3300049582 Bacteria 1035
71 nmdc:mga06r32_6820_c1 3300050510 Bacteria 10267
72 Ga0495612_0083291 3300053078 Bacteria 1346

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037466 Ga0395898_0383730 Ga0395898_0383730_296_1024 236
2 3300039438 Ga0436360_1193094 Ga0436360_1193094_130_840 236
3 iso_pu_bacteria 2513237087 2513591186 236
4 iso_pu_bacteria 2643221623 2644131352 236
5 iso_pu_bacteria 2738543024 2739306263 236
6 iso_pu_bacteria 2996310559 2996315424 236
7 iso_pu_bacteria 3000017691 3000019878 236
8 iso_pu_bacteria 8002285264 8002290547 236
9 iso_pu_bacteria 2512875026 2512973534 237
10 iso_pu_bacteria 2513237089 2513601947 237
11 iso_pu_bacteria 2513237156 2513983402 237
12 iso_pu_bacteria 2513237160 2514003453 237
13 iso_pu_bacteria 2517487022 2517571462 237
14 iso_pu_bacteria 2537561587 2537873610 237
15 iso_pu_bacteria 2582581283 2585166666 237
16 iso_pu_bacteria 2582581299 2585228663 237
17 iso_pu_bacteria 2582581304 2585257274 237
18 iso_pu_bacteria 2582581306 2585266994 237
19 iso_pu_bacteria 2582581307 2585274797 237
20 iso_pu_bacteria 2582581865 2585388035 237
21 iso_pu_bacteria 2585427531 2585562163 237
22 iso_pu_bacteria 2585427608 2585900198 237
23 iso_pu_bacteria 2585427609 2585907909 237
24 iso_pu_bacteria 2585428125 2587983329 237
25 iso_pu_bacteria 2599185210 2599603188 237
26 iso_pu_bacteria 2643221568 2643854884 237
27 iso_pu_bacteria 2643221582 2643921543 237
28 iso_pu_bacteria 2643221634 2644194750 237
29 iso_pu_bacteria 2643221637 2644209508 237
30 iso_pu_bacteria 2643221653 2644299898 237
31 iso_pu_bacteria 2643221689 2644499342 237
32 iso_pu_bacteria 2643221718 2644653036 237
33 iso_pu_bacteria 2643221719 2644658125 237
34 iso_pu_bacteria 2693429783 2694630023 237
35 iso_pu_bacteria 2791355253 2793280974 237
36 iso_pu_bacteria 2802428858 2802717170 237
37 iso_pu_bacteria 2802428859 2802724841 237
38 iso_pu_bacteria 2802428860 2802729592 237
39 iso_pu_bacteria 2802428862 2802743343 237
40 iso_pu_bacteria 2802428863 2802749531 237
41 iso_pu_bacteria 2821123053 2821128770 237
42 iso_pu_bacteria 2824661429 2824662877 237
43 iso_pu_bacteria 2842298080 2842300075 237
44 iso_pu_bacteria 2842357229 2842358986 237
45 iso_pu_bacteria 2855020534 2855021589 237
46 iso_pu_bacteria 2879099564 2879102727 237
47 iso_pu_bacteria 2894652903 2894653953 237
48 iso_pu_bacteria 2896384573 2896390162 237
49 iso_pu_bacteria 2898795034 2898795274 237
50 iso_pu_bacteria 2899275550 2899277951 237
51 iso_pu_bacteria 2899792073 2899795390 237
52 iso_pu_bacteria 2913295892 2913300273 237
53 iso_pu_bacteria 2915980308 2915982381 237
54 iso_pu_bacteria 2916061851 2916064967 237
55 iso_pu_bacteria 2920760137 2920760289 237
56 iso_pu_bacteria 2920822456 2920825980 237
57 iso_pu_bacteria 2921250672 2921252891 237
58 iso_pu_bacteria 2922368715 2922371520 237
59 iso_pu_bacteria 2932809354 2932816669 237
60 iso_pu_bacteria 2932818245 2932822042 237
61 iso_pu_bacteria 2935675223 2935677429 237
62 iso_pu_bacteria 2935760218 2935761807 237
63 iso_pu_bacteria 2935810662 2935814142 237
64 iso_pu_bacteria 2936037263 2936039697 237
65 iso_pu_bacteria 2937029754 2937031812 237
66 iso_pu_bacteria 2937036028 2937036256 237
67 iso_pu_bacteria 2937078374 2937082093 237
68 iso_pu_bacteria 2937084907 2937090030 237
69 iso_pu_bacteria 2957375807 2957381781 237
70 iso_pu_bacteria 2957437181 2957443048 237
71 iso_pu_bacteria 2960591022 2960592281 237
72 iso_pu_bacteria 2960631154 2960633766 237
73 iso_pu_bacteria 2960680706 2960682388 237
74 iso_pu_bacteria 2960693952 2960698185 237
75 iso_pu_bacteria 2967686174 2967690201 237
76 iso_pu_bacteria 2967728569 2967730871 237
77 iso_pu_bacteria 2970026789 2970028765 237
78 iso_pu_bacteria 2970122695 2970124592 237
79 iso_pu_bacteria 2970143518 2970143555 237
80 iso_pu_bacteria 2977530762 2977535036 237
81 iso_pu_bacteria 2977544691 2977550580 237
82 iso_pu_bacteria 2989771324 2989771578 237
83 iso_pu_bacteria 2989776772 2989780061 237
84 iso_pu_bacteria 3003930520 3003930955 237
85 iso_pu_bacteria 8003999396 8004003127 237
86 iso_pu_bacteria 8005658619 8005660928 237
87 iso_pu_bacteria 8054460903 8054463743 237
88 iso_pu_bacteria 8057132660 8057133918 237
89 iso_pu_bacteria 2838736955 2838741974 238
90 iso_pu_bacteria 2841840854 2841845897 238
91 iso_pu_bacteria 2842140634 2842145601 238
92 iso_pu_bacteria 2857531043 2857534077 238
93 3300047472 Ga0495686_0000096 Ga0495686_0000096_76122_76844 239
94 iso_pu_bacteria 2919166419 2919170514 239
95 iso_pu_bacteria 2984587000 2984590934 239
96 3300005614 Ga0068856_100489447 Ga0068856_1004894472 240
97 3300009093 Ga0105240_10215472 Ga0105240_102154723 240
98 3300025913 Ga0207695_10023600 Ga0207695_1002360011 240
99 3300025913 Ga0207695_10286222 Ga0207695_102862222 240
100 3300025924 Ga0207694_10005969 Ga0207694_100059698 240
101 3300026078 Ga0207702_10448821 Ga0207702_104488212 240
102 3300031548 Ga0307408_100000443 Ga0307408_10000044322 240
103 3300037312 Ga0395899_0032562 Ga0395899_0032562_133_858 240
104 3300037312 Ga0395899_0044621 Ga0395899_0044621_1832_2557 240
105 3300038443 Ga0395901_0015459 Ga0395901_0015459_958_1683 240
106 3300039062 Ga0400483_282015 Ga0400483_282015_817_1539 240
107 3300039110 Ga0400487_43381 Ga0400487_43381_450_1172 240
108 3300044765 Ga0466970_0014982 Ga0466970_0014982_994_1716 240
109 3300045051 Ga0451576_0091844 Ga0451576_0091844_935_1657 240
110 3300049571 Ga0501034_0460000 Ga0501034_0460000_377_1099 240
111 3300003203 JGI25406J46586_10016702 JGI25406J46586_100167024 241
112 3300005288 Ga0065714_10089705 Ga0065714_100897052 241
113 3300005290 Ga0065712_10070612 Ga0065712_100706124 241
114 3300005329 Ga0070683_100014019 Ga0070683_1000140192 241
115 3300005331 Ga0070670_100328879 Ga0070670_1003288792 241
116 3300005340 Ga0070689_100116807 Ga0070689_1001168072 241
117 3300005436 Ga0070713_100040845 Ga0070713_1000408453 241
118 3300005458 Ga0070681_10034110 Ga0070681_100341103 241
119 3300005530 Ga0070679_100040420 Ga0070679_1000404203 241
120 3300005618 Ga0068864_100004288 Ga0068864_1000042886 241
121 3300005719 Ga0068861_100873370 Ga0068861_1008733701 241
122 3300005842 Ga0068858_100003889 Ga0068858_1000038894 241
123 3300005985 Ga0081539_10000522 Ga0081539_1000052229 241
124 3300005985 Ga0081539_10112048 Ga0081539_101120481 241
125 3300006847 Ga0075431_100003429 Ga0075431_1000034297 241
126 3300009098 Ga0105245_10160526 Ga0105245_101605262 241
127 3300009101 Ga0105247_10002673 Ga0105247_100026736 241
128 3300009147 Ga0114129_10710996 Ga0114129_107109961 241
129 3300009148 Ga0105243_10675020 Ga0105243_106750202 241
130 3300009177 Ga0105248_10004534 Ga0105248_100045347 241
131 3300009551 Ga0105238_10348775 Ga0105238_103487751 241
132 3300009553 Ga0105249_10831978 Ga0105249_108319781 241
133 3300014325 Ga0163163_10004574 Ga0163163_100045746 241
134 3300025913 Ga0207695_10140947 Ga0207695_101409472 241
135 3300025923 Ga0207681_10252410 Ga0207681_102524102 241
136 3300025927 Ga0207687_10027678 Ga0207687_100276785 241
137 3300025928 Ga0207700_10012013 Ga0207700_100120133 241
138 3300025936 Ga0207670_10095502 Ga0207670_100955022 241
139 3300025940 Ga0207691_10602654 Ga0207691_106026542 241
140 3300025941 Ga0207711_10012888 Ga0207711_100128883 241
141 3300025942 Ga0207689_10014351 Ga0207689_100143512 241
142 3300025944 Ga0207661_10009867 Ga0207661_1000986710 241
143 3300025945 Ga0207679_10086888 Ga0207679_100868883 241
144 3300026035 Ga0207703_10011391 Ga0207703_100113914 241
145 3300026035 Ga0207703_10521046 Ga0207703_105210462 241
146 3300026088 Ga0207641_10079732 Ga0207641_100797322 241
147 3300026095 Ga0207676_10008419 Ga0207676_100084194 241
148 3300031730 Ga0307516_10091638 Ga0307516_100916383 241
149 3300032002 Ga0307416_100533519 Ga0307416_1005335192 241
150 3300035398 Ga0316574_0334928 Ga0316574_0334928_223_948 241
151 3300039447 Ga0436361_0517945 Ga0436361_0517945_97_822 241
152 3300045051 Ga0451576_0021714 Ga0451576_0021714_80_805 241
153 3300048907 Ga0496104_0047611 Ga0496104_0047611_1596_2321 241
154 3300048911 Ga0496108_0013249 Ga0496108_0013249_3254_3979 241
155 3300048915 Ga0496112_0046212 Ga0496112_0046212_895_1620 241
156 3300048916 Ga0496113_0005103 Ga0496113_0005103_3118_3843 241
157 3300048924 Ga0496121_0088458 Ga0496121_0088458_38_829 241
158 3300048929 Ga0496126_0562307 Ga0496126_0562307_33_824 241
159 3300049571 Ga0501034_0158550 Ga0501034_0158550_53_781 241
160 3300049578 Ga0501042_0151765 Ga0501042_0151765_162_887 241
161 3300049580 Ga0501046_0125060 Ga0501046_0125060_384_1235 241
162 3300049582 Ga0501048_0361904 Ga0501048_0361904_295_1020 241
163 3300050510 nmdc:mga06r32_6820_c1 nmdc:mga06r32_6820_c1_5119_5844 241
164 3300053078 Ga0495612_0083291 Ga0495612_0083291_232_957 241
165 iso_pu_bacteria 2876761206 2876770029 241
166 iso_pu_bacteria 2978969890 2978972682 241

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

10

235

0.97

PF00106

adh_short

short chain dehydrogenase

4

188

0.95

PF08659

KR

KR domain

5

178

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kms-assembly1.cif.gz_A-2 crystal structure of acetoacetyl-coa reductase from rickettsia felis 0.9623 1 238
4kms-assembly1.cif.gz_B-2 crystal structure of acetoacetyl-coa reductase from rickettsia felis 0.9577 1 238
4rzi-assembly1.cif.gz_B crystal structure of phab from synechocystis sp. pcc 6803 0.9522 3 236
4k6c-assembly1.cif.gz_A x-ray crystal structure of a putative acetoacyl-coa reductase from burkholderia cenocepacia 0.9508 3 241
1uls-assembly1.cif.gz_A crystal structure of tt0140 from thermus thermophilus hb8 0.9494 2 237
ID Description Score Start End Superfamily
4kmsB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9577 1 238 3.40.50.720
4rziB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9522 3 236 3.40.50.720
1ulsC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9426 2 237 3.40.50.720
3ay6A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9418 2 237 3.40.50.720
4kmsB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9412 1 238 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A529IRX2-F1-model_v4 deleted 0.9807 1 209
AF-A0A7R8W4L7-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) 0.9798 1 236 GO:0005737
GO:0018454
GO:0042619
AF-A0A6A5LF29-F1-model_v4 deleted 0.9795 1 228
AF-A0A526RE03-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9789 1 174 GO:0016491
AF-A0A349QD71-F1-model_v4 deleted 0.9782 1 184

Feature Viewer

pLDDT pTM Quality
91.95 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map