F248797

General Info

Members Datasets Scaffolds Average Seq Length
166 93 166 405

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0061107|Ga0373937_0061107_1086_2435
Length 449
Sequence MSAGIECKKAARMADVVNAGYPGYCLQTMDALPTVLLRPGEGDRIVAGHPWVYQGEILRLTSTVADGDLVQVKDHRQRFLGVGFFNAKSKINVRVLSPERVEINEAFFEDRIRAALAVRQKHLPNAASFRVVNAESDFLSGLIVDKYEDVLVVQISSLGMDRRKTQIVAALAKIFSPRAILERGDIASRKFEGLAEANGVLAGEFGDRKALSASSETGGNADKTVRAPRITVDLNGLKFETDLAAGHKTGLYLDQQVNYQAVAQFARGAQVLDCFSFLGGFGLHAARAGAAHVHLLDQSAEAIAASQRNATANRLADICSFEAVNVFDWLKSQTAVKPHEKVVPRFDLIVLDPPSFTRNRASVPDALRGYKEIHLRALKLLRAGGTLATFCCSHHVDATTFQDVILSAAYDTRRILRRVATYSQSLDHPVIPMIPETEYLKGFAFEVVR

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
16 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
17 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
18 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
20 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
21 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
22 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
23 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
24 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
34 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
35 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
36 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
37 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
38 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
39 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
40 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
41 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
42 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
43 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
44 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
45 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
46 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
47 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
48 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
49 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
50 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
51 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
52 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
53 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
54 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
55 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
56 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
57 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
58 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
59 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
60 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
61 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
62 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
63 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
64 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
65 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
66 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
67 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
68 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
69 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
70 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
71 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
72 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
73 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
74 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
75 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
76 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
77 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
78 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
79 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
80 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
81 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
82 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
83 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
92 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
93 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.6
Nodule 0
Rhizoplane 0
Rhizosphere 98.19
Stem 0
Stem Tuber 0
Unclassified 1.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10049688 3300003320 Bacteria 10834
2 rootH2_10073321 3300003320 Bacteria 2055
3 Ga0070683_100284514 3300005329 Unclassified 1573
4 Ga0070690_100186894 3300005330 Bacteria 1434
5 Ga0070689_100099444 3300005340 Unclassified 2301
6 Ga0070691_10066335 3300005341 Bacteria 1744
7 Ga0070714_100006729 3300005435 Bacteria 8906
8 Ga0070711_100004225 3300005439 Bacteria 8439
9 Ga0070679_100198202 3300005530 Unclassified 1974
10 Ga0070679_100199118 3300005530 Bacteria 1969
11 Ga0070686_100083389 3300005544 Unclassified 2122
12 Ga0070686_100159421 3300005544 Bacteria 1588
13 Ga0068855_100040042 3300005563 Bacteria 5562
14 Ga0068857_100070247 3300005577 Bacteria 3119
15 Ga0068856_100000264 3300005614 Bacteria 57155
16 Ga0068859_100027096 3300005617 Bacteria 5749
17 Ga0068859_100498177 3300005617 Unclassified 1313
18 Ga0081455_10077252 3300005937 Unclassified 2739
19 Ga0097620_100027096 3300006931 Bacteria 5749
20 Ga0097620_100498217 3300006931 Unclassified 1313
21 Ga0099794_10048990 3300007265 Unclassified 2029
22 Ga0105240_10008225 3300009093 Bacteria 14951
23 Ga0105240_10347508 3300009093 Bacteria 1683
24 Ga0111539_10151420 3300009094 Unclassified 2715
25 Ga0105242_10162316 3300009176 Bacteria 1957
26 Ga0105238_10071013 3300009551 Bacteria 3480
27 Ga0157378_10132624 3300013297 Bacteria 2307
28 Ga0157375_10047678 3300013308 Unclassified 4186
29 Ga0163163_10000049 3300014325 Bacteria 130036
30 Ga0163163_10130104 3300014325 Bacteria 2557
31 Ga0207707_10195462 3300025912 Unclassified 1764
32 Ga0207695_10031221 3300025913 Bacteria 5848
33 Ga0207695_10096702 3300025913 Bacteria 2954
34 Ga0207695_10158296 3300025913 Bacteria 2198
35 Ga0207695_10325977 3300025913 Unclassified 1425
36 Ga0207663_10002973 3300025916 Bacteria 8198
37 Ga0207694_10062568 3300025924 Bacteria 2897
38 Ga0207664_10005143 3300025929 Bacteria 8913
39 Ga0207670_10181329 3300025936 Unclassified 1586
40 Ga0207703_10309900 3300026035 Unclassified 1443
41 Ga0207702_10004495 3300026078 Bacteria 12379
42 Ga0207674_10085496 3300026116 Unclassified 3149
43 Ga0265337_1000339 3300028556 Bacteria 24999
44 Ga0265337_1005919 3300028556 Bacteria 4786
45 Ga0265337_1012560 3300028556 Bacteria 2874
46 Ga0265337_1012847 3300028556 Bacteria 2830
47 Ga0265337_1022526 3300028556 Bacteria 1950
48 Ga0265326_10024670 3300028558 Bacteria 1715
49 Ga0265319_1000016 3300028563 Bacteria 176245
50 Ga0265319_1014784 3300028563 Bacteria 3047
51 Ga0265334_10015499 3300028573 Unclassified 3165
52 Ga0265318_10049583 3300028577 Unclassified 1579
53 Ga0265323_10002797 3300028653 Bacteria 7852
54 Ga0265323_10029352 3300028653 Bacteria 2057
55 Ga0265336_10000737 3300028666 Bacteria 17345
56 Ga0265336_10005792 3300028666 Bacteria 4521
57 Ga0265338_10000030 3300028800 Bacteria 260974
58 Ga0265338_10000062 3300028800 Bacteria 196060
59 Ga0265338_10000210 3300028800 Bacteria 107885
60 Ga0265338_10000723 3300028800 Bacteria 56376
61 Ga0265338_10001246 3300028800 Bacteria 41955
62 Ga0265338_10001539 3300028800 Bacteria 37247
63 Ga0265338_10002993 3300028800 Bacteria 24469
64 Ga0265338_10003708 3300028800 Bacteria 21260
65 Ga0265338_10004221 3300028800 Bacteria 19557
66 Ga0265338_10005003 3300028800 Bacteria 17529
67 Ga0265338_10009072 3300028800 Bacteria 11963
68 Ga0265338_10020924 3300028800 Bacteria 6848
69 Ga0265338_10028809 3300028800 Bacteria 5527
70 Ga0265338_10029053 3300028800 Bacteria 5494
71 Ga0265338_10029195 3300028800 Bacteria 5474
72 Ga0265338_10032138 3300028800 Bacteria 5127
73 Ga0265338_10099320 3300028800 Bacteria 2378
74 Ga0265338_10169036 3300028800 Unclassified 1679
75 Ga0265338_10205470 3300028800 Bacteria 1482
76 Ga0265324_10000218 3300029957 Bacteria 44125
77 Ga0265324_10000888 3300029957 Bacteria 19007
78 Ga0265324_10004259 3300029957 Bacteria 6535
79 Ga0265324_10031422 3300029957 Bacteria 1859
80 Ga0265328_10008983 3300031239 Unclassified 4092
81 Ga0265320_10000471 3300031240 Bacteria 31514
82 Ga0265320_10001558 3300031240 Bacteria 16509
83 Ga0265320_10010078 3300031240 Unclassified 5651
84 Ga0265320_10021997 3300031240 Bacteria 3420
85 Ga0265320_10075607 3300031240 Bacteria 1580
86 Ga0265325_10012188 3300031241 Unclassified 4919
87 Ga0265329_10000279 3300031242 Bacteria 27064
88 Ga0265329_10015203 3300031242 Bacteria 2694
89 Ga0265340_10015114 3300031247 Bacteria 4016
90 Ga0265340_10030161 3300031247 Bacteria 2720
91 Ga0265339_10116342 3300031249 Bacteria 1378
92 Ga0265327_10002162 3300031251 Bacteria 21650
93 Ga0265327_10018661 3300031251 Bacteria 4291
94 Ga0265327_10038525 3300031251 Bacteria 2608
95 Ga0265316_10015669 3300031344 Bacteria 6615
96 Ga0265316_10028300 3300031344 Bacteria 4625
97 Ga0265316_10046843 3300031344 Bacteria 3423
98 Ga0265316_10142348 3300031344 Bacteria 1800
99 Ga0265313_10004913 3300031595 Bacteria 10018
100 Ga0265313_10005517 3300031595 Bacteria 9272
101 Ga0265313_10042627 3300031595 Bacteria 2227
102 Ga0265314_10000020 3300031711 Bacteria 307052
103 Ga0265314_10025452 3300031711 Bacteria 4463
104 Ga0316583_10023307 3300032133 Bacteria 2213
105 Ga0373928_0000345 3300035084 Bacteria 9277
106 Ga0373944_0000343 3300035089 Bacteria 10457
107 Ga0373932_0000002 3300035112 Bacteria 711821
108 Ga0373962_0000211 3300035242 Bacteria 12304
109 Ga0373931_0000012 3300035691 Bacteria 267735
110 Ga0373927_0008407 3300035695 Bacteria 6943
111 Ga0373937_0061107 3300036401 Unclassified 3463
112 Ga0373937_0202952 3300036401 Bacteria 1864
113 Ga0373925_0000065 3300037068 Bacteria 114215
114 Ga0373925_0011241 3300037068 Bacteria 6493
115 Ga0373925_0054824 3300037068 Unclassified 2982
116 Ga0451577_0012735 3300042876 Bacteria 7891
117 Ga0453684_0025165 3300044712 Bacteria 8653
118 Ga0453684_0048356 3300044712 Bacteria 5627
119 Ga0453684_0070168 3300044712 Unclassified 4439
120 Ga0451576_0007509 3300045051 Bacteria 13012
121 Ga0451576_0117947 3300045051 Bacteria 2763
122 Ga0451576_0164103 3300045051 Bacteria 2318
123 Ga0495629_0095887 3300046459 Unclassified 2069
124 Ga0495651_0162418 3300046462 Unclassified 1599
125 Ga0495582_0010040 3300046473 Bacteria 5212
126 Ga0495618_0003933 3300046514 Bacteria 9168
127 Ga0495618_0040580 3300046514 Bacteria 2930
128 Ga0495630_0000119 3300046517 Bacteria 62254
129 Ga0495630_0109242 3300046517 Bacteria 2095
130 Ga0495630_0123487 3300046517 Unclassified 1964
131 Ga0495630_0154094 3300046517 Unclassified 1749
132 Ga0495666_0010318 3300046526 Bacteria 4657
133 Ga0495666_0055944 3300046526 Bacteria 1890
134 Ga0495586_0000520 3300046535 Bacteria 22726
135 Ga0495586_0024789 3300046535 Bacteria 3208
136 Ga0495586_0033351 3300046535 Bacteria 2763
137 Ga0495622_0021283 3300046557 Unclassified 3020
138 Ga0495634_0006980 3300046642 Bacteria 8524
139 Ga0495634_0013203 3300046642 Bacteria 5970
140 Ga0495635_0031041 3300046663 Unclassified 3712
141 Ga0495647_0013632 3300046681 Unclassified 2821
142 Ga0495658_0011619 3300046683 Unclassified 4435
143 Ga0495613_0012109 3300046689 Bacteria 6410
144 Ga0495613_0106029 3300046689 Unclassified 2028
145 Ga0495624_0042070 3300046690 Bacteria 2920
146 Ga0495581_0032007 3300047315 Unclassified 3046
147 Ga0495674_0000192 3300047319 Bacteria 49134
148 Ga0495676_0000717 3300047321 Bacteria 27596
149 Ga0495680_0069131 3300047322 Unclassified 2695
150 Ga0495675_0062291 3300047444 Bacteria 2362
151 Ga0495675_0148933 3300047444 Bacteria 1447
152 Ga0501031_0000229 3300049568 Bacteria 31986
153 Ga0501031_0183830 3300049568 Unclassified 1365
154 Ga0501033_0010294 3300049570 Bacteria 7176
155 Ga0501033_0038458 3300049570 Bacteria 3576
156 Ga0501033_0075487 3300049570 Bacteria 2474
157 Ga0501036_0108544 3300049572 Unclassified 2346
158 Ga0501037_0153475 3300049573 Unclassified 1645
159 Ga0501039_0197228 3300049575 Unclassified 1583
160 Ga0501043_0055796 3300049579 Bacteria 3104
161 Ga0501047_0083344 3300049581 Unclassified 3073
162 Ga0501035_0023523 3300049822 Bacteria 5653
163 Ga0501044_0000811 3300049823 Bacteria 37607
164 Ga0501044_0268412 3300049823 Bacteria 1643
165 nmdc:mga08x19_226771_c1 3300050514 Bacteria 1285
166 Ga0500650_0011413 3300053098 Bacteria 3656

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046557 Ga0495622_0021283 Ga0495622_0021283_29_1072 347
2 3300009551 Ga0105238_10071013 Ga0105238_100710133 350
3 3300025936 Ga0207670_10181329 Ga0207670_101813292 359
4 3300050514 nmdc:mga08x19_226771_c1 nmdc:mga08x19_226771_c1_155_1237 360
5 3300044712 Ga0453684_0048356 Ga0453684_0048356_2070_3305 379
6 3300005937 Ga0081455_10077252 Ga0081455_100772522 387
7 3300042876 Ga0451577_0012735 Ga0451577_0012735_1837_3069 394
8 3300031251 Ga0265327_10018661 Ga0265327_100186611 395
9 3300005617 Ga0068859_100498177 Ga0068859_1004981771 399
10 3300006931 Ga0097620_100498217 Ga0097620_1004982171 399
11 3300014325 Ga0163163_10000049 Ga0163163_1000004916 399
12 3300035695 Ga0373927_0008407 Ga0373927_0008407_3036_4247 399
13 3300037068 Ga0373925_0011241 Ga0373925_0011241_4196_5407 399
14 3300044712 Ga0453684_0070168 Ga0453684_0070168_189_1400 399
15 3300046517 Ga0495630_0154094 Ga0495630_0154094_218_1489 399
16 3300003320 rootH2_10049688 rootH2_100496885 400
17 3300003320 rootH2_10073321 rootH2_100733212 400
18 3300005329 Ga0070683_100284514 Ga0070683_1002845141 400
19 3300005330 Ga0070690_100186894 Ga0070690_1001868941 400
20 3300005340 Ga0070689_100099444 Ga0070689_1000994442 400
21 3300005341 Ga0070691_10066335 Ga0070691_100663352 400
22 3300005435 Ga0070714_100006729 Ga0070714_1000067294 400
23 3300005439 Ga0070711_100004225 Ga0070711_1000042258 400
24 3300005530 Ga0070679_100198202 Ga0070679_1001982022 400
25 3300005530 Ga0070679_100199118 Ga0070679_1001991182 400
26 3300005544 Ga0070686_100083389 Ga0070686_1000833891 400
27 3300005544 Ga0070686_100159421 Ga0070686_1001594211 400
28 3300005563 Ga0068855_100040042 Ga0068855_1000400425 400
29 3300005577 Ga0068857_100070247 Ga0068857_1000702472 400
30 3300005614 Ga0068856_100000264 Ga0068856_10000026425 400
31 3300005617 Ga0068859_100027096 Ga0068859_1000270963 400
32 3300006931 Ga0097620_100027096 Ga0097620_1000270963 400
33 3300007265 Ga0099794_10048990 Ga0099794_100489902 400
34 3300009093 Ga0105240_10008225 Ga0105240_100082254 400
35 3300009093 Ga0105240_10347508 Ga0105240_103475081 400
36 3300009094 Ga0111539_10151420 Ga0111539_101514202 400
37 3300009176 Ga0105242_10162316 Ga0105242_101623162 400
38 3300013297 Ga0157378_10132624 Ga0157378_101326242 400
39 3300013308 Ga0157375_10047678 Ga0157375_100476783 400
40 3300014325 Ga0163163_10130104 Ga0163163_101301042 400
41 3300025912 Ga0207707_10195462 Ga0207707_101954622 400
42 3300025913 Ga0207695_10031221 Ga0207695_100312212 400
43 3300025913 Ga0207695_10096702 Ga0207695_100967022 400
44 3300025913 Ga0207695_10158296 Ga0207695_101582961 400
45 3300025913 Ga0207695_10325977 Ga0207695_103259771 400
46 3300025916 Ga0207663_10002973 Ga0207663_100029738 400
47 3300025924 Ga0207694_10062568 Ga0207694_100625682 400
48 3300025929 Ga0207664_10005143 Ga0207664_1000514310 400
49 3300026035 Ga0207703_10309900 Ga0207703_103099002 400
50 3300026078 Ga0207702_10004495 Ga0207702_100044952 400
51 3300026116 Ga0207674_10085496 Ga0207674_100854963 400
52 3300028556 Ga0265337_1000339 Ga0265337_10003394 400
53 3300028556 Ga0265337_1005919 Ga0265337_10059197 400
54 3300028556 Ga0265337_1012560 Ga0265337_10125601 400
55 3300028556 Ga0265337_1012847 Ga0265337_10128473 400
56 3300028556 Ga0265337_1022526 Ga0265337_10225261 400
57 3300028558 Ga0265326_10024670 Ga0265326_100246702 400
58 3300028563 Ga0265319_1000016 Ga0265319_10000163 400
59 3300028563 Ga0265319_1014784 Ga0265319_10147842 400
60 3300028573 Ga0265334_10015499 Ga0265334_100154992 400
61 3300028577 Ga0265318_10049583 Ga0265318_100495832 400
62 3300028653 Ga0265323_10002797 Ga0265323_100027975 400
63 3300028653 Ga0265323_10029352 Ga0265323_100293522 400
64 3300028666 Ga0265336_10000737 Ga0265336_100007376 400
65 3300028666 Ga0265336_10005792 Ga0265336_100057924 400
66 3300028800 Ga0265338_10000030 Ga0265338_10000030198 400
67 3300028800 Ga0265338_10000062 Ga0265338_10000062115 400
68 3300028800 Ga0265338_10000210 Ga0265338_1000021047 400
69 3300028800 Ga0265338_10000723 Ga0265338_1000072325 400
70 3300028800 Ga0265338_10001246 Ga0265338_1000124613 400
71 3300028800 Ga0265338_10001539 Ga0265338_1000153938 400
72 3300028800 Ga0265338_10002993 Ga0265338_100029939 400
73 3300028800 Ga0265338_10003708 Ga0265338_1000370813 400
74 3300028800 Ga0265338_10004221 Ga0265338_100042212 400
75 3300028800 Ga0265338_10005003 Ga0265338_1000500312 400
76 3300028800 Ga0265338_10009072 Ga0265338_100090724 400
77 3300028800 Ga0265338_10020924 Ga0265338_100209242 400
78 3300028800 Ga0265338_10028809 Ga0265338_100288093 400
79 3300028800 Ga0265338_10029053 Ga0265338_100290533 400
80 3300028800 Ga0265338_10029195 Ga0265338_100291952 400
81 3300028800 Ga0265338_10032138 Ga0265338_100321386 400
82 3300028800 Ga0265338_10099320 Ga0265338_100993202 400
83 3300028800 Ga0265338_10169036 Ga0265338_101690362 400
84 3300028800 Ga0265338_10205470 Ga0265338_102054702 400
85 3300029957 Ga0265324_10000218 Ga0265324_1000021821 400
86 3300029957 Ga0265324_10000888 Ga0265324_100008885 400
87 3300029957 Ga0265324_10004259 Ga0265324_100042597 400
88 3300029957 Ga0265324_10031422 Ga0265324_100314222 400
89 3300031239 Ga0265328_10008983 Ga0265328_100089833 400
90 3300031240 Ga0265320_10000471 Ga0265320_100004712 400
91 3300031240 Ga0265320_10001558 Ga0265320_1000155813 400
92 3300031240 Ga0265320_10010078 Ga0265320_100100783 400
93 3300031240 Ga0265320_10021997 Ga0265320_100219971 400
94 3300031240 Ga0265320_10075607 Ga0265320_100756072 400
95 3300031241 Ga0265325_10012188 Ga0265325_100121884 400
96 3300031242 Ga0265329_10000279 Ga0265329_1000027919 400
97 3300031242 Ga0265329_10015203 Ga0265329_100152031 400
98 3300031247 Ga0265340_10015114 Ga0265340_100151142 400
99 3300031247 Ga0265340_10030161 Ga0265340_100301612 400
100 3300031249 Ga0265339_10116342 Ga0265339_101163421 400
101 3300031251 Ga0265327_10002162 Ga0265327_100021626 400
102 3300031251 Ga0265327_10038525 Ga0265327_100385253 400
103 3300031344 Ga0265316_10015669 Ga0265316_100156692 400
104 3300031344 Ga0265316_10028300 Ga0265316_100283005 400
105 3300031344 Ga0265316_10046843 Ga0265316_100468434 400
106 3300031344 Ga0265316_10142348 Ga0265316_101423482 400
107 3300031595 Ga0265313_10004913 Ga0265313_100049134 400
108 3300031595 Ga0265313_10005517 Ga0265313_100055172 400
109 3300031595 Ga0265313_10042627 Ga0265313_100426272 400
110 3300031711 Ga0265314_10000020 Ga0265314_10000020114 400
111 3300031711 Ga0265314_10025452 Ga0265314_100254523 400
112 3300032133 Ga0316583_10023307 Ga0316583_100233072 400
113 3300035084 Ga0373928_0000345 Ga0373928_0000345_8011_9213 400
114 3300035089 Ga0373944_0000343 Ga0373944_0000343_7730_8932 400
115 3300035112 Ga0373932_0000002 Ga0373932_0000002_245330_246532 400
116 3300035242 Ga0373962_0000211 Ga0373962_0000211_1788_2990 400
117 3300035691 Ga0373931_0000012 Ga0373931_0000012_245349_246551 400
118 3300036401 Ga0373937_0061107 Ga0373937_0061107_1086_2435 400
119 3300036401 Ga0373937_0202952 Ga0373937_0202952_407_1609 400
120 3300037068 Ga0373925_0000065 Ga0373925_0000065_12290_13492 400
121 3300037068 Ga0373925_0054824 Ga0373925_0054824_1481_2683 400
122 3300044712 Ga0453684_0025165 Ga0453684_0025165_2033_3235 400
123 3300045051 Ga0451576_0007509 Ga0451576_0007509_5755_6990 400
124 3300045051 Ga0451576_0117947 Ga0451576_0117947_444_1646 400
125 3300045051 Ga0451576_0164103 Ga0451576_0164103_970_2181 400
126 3300046459 Ga0495629_0095887 Ga0495629_0095887_789_2054 400
127 3300046462 Ga0495651_0162418 Ga0495651_0162418_48_1250 400
128 3300046473 Ga0495582_0010040 Ga0495582_0010040_3504_4706 400
129 3300046514 Ga0495618_0003933 Ga0495618_0003933_5917_7266 400
130 3300046514 Ga0495618_0040580 Ga0495618_0040580_1175_2377 400
131 3300046517 Ga0495630_0000119 Ga0495630_0000119_10441_11643 400
132 3300046517 Ga0495630_0109242 Ga0495630_0109242_98_1300 400
133 3300046517 Ga0495630_0123487 Ga0495630_0123487_126_1346 400
134 3300046526 Ga0495666_0010318 Ga0495666_0010318_1409_2611 400
135 3300046526 Ga0495666_0055944 Ga0495666_0055944_291_1493 400
136 3300046535 Ga0495586_0000520 Ga0495586_0000520_11730_12932 400
137 3300046535 Ga0495586_0024789 Ga0495586_0024789_1888_3093 400
138 3300046535 Ga0495586_0033351 Ga0495586_0033351_314_1516 400
139 3300046642 Ga0495634_0006980 Ga0495634_0006980_3624_4826 400
140 3300046642 Ga0495634_0013203 Ga0495634_0013203_4229_5578 400
141 3300046663 Ga0495635_0031041 Ga0495635_0031041_1884_3233 400
142 3300046681 Ga0495647_0013632 Ga0495647_0013632_638_1840 400
143 3300046683 Ga0495658_0011619 Ga0495658_0011619_2321_3538 400
144 3300046689 Ga0495613_0012109 Ga0495613_0012109_843_2192 400
145 3300046689 Ga0495613_0106029 Ga0495613_0106029_330_1532 400
146 3300046690 Ga0495624_0042070 Ga0495624_0042070_128_1330 400
147 3300047315 Ga0495581_0032007 Ga0495581_0032007_394_1596 400
148 3300047319 Ga0495674_0000192 Ga0495674_0000192_8968_10170 400
149 3300047321 Ga0495676_0000717 Ga0495676_0000717_12212_13414 400
150 3300047322 Ga0495680_0069131 Ga0495680_0069131_1210_2559 400
151 3300047444 Ga0495675_0062291 Ga0495675_0062291_85_1287 400
152 3300047444 Ga0495675_0148933 Ga0495675_0148933_77_1297 400
153 3300049568 Ga0501031_0000229 Ga0501031_0000229_17223_18437 400
154 3300049568 Ga0501031_0183830 Ga0501031_0183830_138_1352 400
155 3300049570 Ga0501033_0010294 Ga0501033_0010294_3167_4381 400
156 3300049570 Ga0501033_0038458 Ga0501033_0038458_337_1551 400
157 3300049570 Ga0501033_0075487 Ga0501033_0075487_422_1624 400
158 3300049572 Ga0501036_0108544 Ga0501036_0108544_1088_2302 400
159 3300049573 Ga0501037_0153475 Ga0501037_0153475_307_1521 400
160 3300049575 Ga0501039_0197228 Ga0501039_0197228_316_1530 400
161 3300049579 Ga0501043_0055796 Ga0501043_0055796_554_1762 400
162 3300049581 Ga0501047_0083344 Ga0501047_0083344_1479_2693 400
163 3300049822 Ga0501035_0023523 Ga0501035_0023523_4066_5280 400
164 3300049823 Ga0501044_0000811 Ga0501044_0000811_30724_31938 400
165 3300049823 Ga0501044_0268412 Ga0501044_0268412_264_1466 400
166 3300053098 Ga0500650_0011413 Ga0500650_0011413_1265_2467 400

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17785

PUA_3

PUA-like domain

35

98

0.98

PF13847

Methyltransf_31

Methyltransferase domain

266

423

0.81

PF10672

Methyltrans_SAM

S-adenosylmethionine-dependent methyltransferase

188

403

0.8

PF03602

Cons_hypoth95

Conserved hypothetical protein 95

255

379

0.75

PF05175

MTS

Methyltransferase small domain

259

422

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dmg-assembly1.cif.gz_B thermus thermophilus m5c1942 methyltransferase rlmo 0.9425 1 400
2cww-assembly1.cif.gz_A-2 crystal structure of thermus thermophilus ttha1280, a putative sam-dependent rna methyltransferase, in complex with s-adenosyl-l-homocysteine 0.9404 6 399
2cww-assembly1.cif.gz_A-2 crystal structure of thermus thermophilus ttha1280, a putative sam-dependent rna methyltransferase, in complex with s-adenosyl-l-homocysteine 0.9356 6 399
4dmg-assembly1.cif.gz_B thermus thermophilus m5c1942 methyltransferase rlmo 0.9354 1 400
1wxw-assembly1.cif.gz_A crystal structure of tt1595, a putative sam-dependent methyltransferase from thermus thermophillus hb8 0.9303 6 399
ID Description Score Start End Superfamily
af_I1KW47_39_110_2.30.130.10 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain 0.9754 4 71 2.30.130.10
3c0kB01 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain 0.9682 6 71 2.30.130.10
af_Q8IKX0_132_231_3.30.750.80 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;RNA methyltransferase domain (HRMD) like 0.9614 74 172 3.30.750.80
af_Q8I4W7_220_326_3.30.750.80 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;RNA methyltransferase domain (HRMD) like 0.9467 99 179 3.30.750.80
af_Q8IKX0_444_586_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9463 298 397 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7C5QEA7-F1-model_v4 Class I SAM-dependent rRNA methyltransferase 0.9796 4 399 GO:0003723
GO:0005737
GO:0006364
GO:0008168
GO:0032259
AF-A0A1F5RHP5-F1-model_v4 Uncharacterized protein 0.9791 4 398 GO:0003723
GO:0005737
GO:0008168
GO:0032259
AF-A0A7C5QEA7-F1-model_v4 Class I SAM-dependent rRNA methyltransferase 0.9771 4 399 GO:0003723
GO:0005737
GO:0006364
GO:0008168
GO:0032259
AF-A0A2V5SVP9-F1-model_v4 rRNA large subunit methyltransferase I 0.9757 296 399 GO:0005737
GO:0008168
GO:0032259
AF-A0A1F5RHP5-F1-model_v4 Uncharacterized protein 0.9742 4 398 GO:0003723
GO:0005737
GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
92.59 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map