F248601

General Info

Members Datasets Scaffolds Average Seq Length
166 123 166 154

Family's Representative Sequence

Representative Sequence 3300026118|Ga0207675_100184228|Ga0207675_1001842283
Length 178
Sequence MGSTGMPVPANLITQQRRSDPEWAMLQTGNVAPDFALENTSRQVIRLSDFRGKKNVVIAFHPLAFTPVCSVQMQNYQKALPVFDSLDTVVLGISFDLGPSHAAWANSLGGLSFDLLSDVHPHGKVARDYGVFREGDSLPGRAIFVVDKAGVIRWAKLHDIPEQPDLNELLGVLNDVGP

Samples

Sample ID Description Type Environment
1 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
61 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
63 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
64 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
65 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
66 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
67 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
68 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
69 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
70 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
71 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
72 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
73 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
74 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
75 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
76 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
77 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
78 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
79 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
80 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
81 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
82 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
83 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
84 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
85 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
86 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
87 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
88 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
89 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
90 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
91 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
92 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
93 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
94 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
95 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
103 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
104 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
105 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
106 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
107 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
108 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
109 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
110 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
111 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
112 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
113 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
114 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
115 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
116 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
117 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
118 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
119 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
120 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
121 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
122 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
123 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.02
Rhizosphere 93.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24034J26672_10017737 3300002239 Bacteria 1103
2 Ga0065712_10005525 3300005290 Bacteria 4655
3 Ga0065712_10022348 3300005290 Bacteria 1633
4 Ga0065712_10073085 3300005290 Bacteria 4509
5 Ga0065715_10024624 3300005293 Bacteria 1555
6 Ga0065715_10423892 3300005293 Bacteria 855
7 Ga0070670_100277932 3300005331 Unclassified 1462
8 Ga0070677_10199885 3300005333 Unclassified 964
9 Ga0068869_100310967 3300005334 Bacteria 1275
10 Ga0070682_100334644 3300005337 Bacteria 1123
11 Ga0068868_100552650 3300005338 Unclassified 1015
12 Ga0070689_100065750 3300005340 Bacteria 2825
13 Ga0070668_100314573 3300005347 Bacteria 1317
14 Ga0070669_100170503 3300005353 Bacteria 1696
15 Ga0070669_101132943 3300005353 Bacteria 674
16 Ga0070675_101393835 3300005354 Bacteria 646
17 Ga0070671_100845278 3300005355 Bacteria 798
18 Ga0070674_100009971 3300005356 Bacteria 5718
19 Ga0070673_101055729 3300005364 Unclassified 758
20 Ga0070700_100566283 3300005441 Unclassified 885
21 Ga0070663_100760002 3300005455 Bacteria 828
22 Ga0070678_102131986 3300005456 Bacteria 531
23 Ga0068867_100518891 3300005459 Bacteria 1027
24 Ga0070672_100795754 3300005543 Unclassified 832
25 Ga0070672_101377136 3300005543 Bacteria 631
26 Ga0070693_100098038 3300005547 Bacteria 1780
27 Ga0070665_100293909 3300005548 Bacteria 1627
28 Ga0068852_100929525 3300005616 Unclassified 887
29 Ga0068859_100066102 3300005617 Bacteria 3650
30 Ga0068866_10567347 3300005718 Unclassified 761
31 Ga0068861_101064209 3300005719 Bacteria 776
32 Ga0068863_100052211 3300005841 Bacteria 3875
33 Ga0068862_100718806 3300005844 Unclassified 969
34 Ga0097621_100067209 3300006237 Unclassified 2954
35 Ga0068871_100193129 3300006358 Bacteria 1755
36 Ga0068871_100415561 3300006358 Bacteria 1200
37 Ga0075428_100274599 3300006844 Unclassified 1813
38 Ga0075428_101613937 3300006844 Unclassified 678
39 Ga0075430_100009691 3300006846 Bacteria 8136
40 Ga0075430_100538966 3300006846 Unclassified 963
41 Ga0075431_100038286 3300006847 Bacteria 4937
42 Ga0075431_100103102 3300006847 Bacteria 2944
43 Ga0075431_100177972 3300006847 Bacteria 2183
44 Ga0075434_100903268 3300006871 Bacteria 898
45 Ga0075429_100097366 3300006880 Bacteria 2567
46 Ga0068865_100378514 3300006881 Bacteria 1154
47 Ga0068865_101222924 3300006881 Unclassified 665
48 Ga0097620_100066105 3300006931 Bacteria 3650
49 Ga0111539_10077104 3300009094 Bacteria 3923
50 Ga0111539_10512603 3300009094 Bacteria 1397
51 Ga0114129_10012984 3300009147 Bacteria 11859
52 Ga0114129_10078261 3300009147 Bacteria 4600
53 Ga0105243_11545703 3300009148 Bacteria 689
54 Ga0105243_11938154 3300009148 Bacteria 623
55 Ga0105248_10045517 3300009177 Bacteria 4920
56 Ga0105248_11254950 3300009177 Unclassified 838
57 Ga0105249_12456475 3300009553 Bacteria 594
58 Ga0157378_10478468 3300013297 Unclassified 1240
59 Ga0157378_10610326 3300013297 Bacteria 1103
60 Ga0157380_10014787 3300014326 Bacteria 5716
61 Ga0157380_10153068 3300014326 Bacteria 1996
62 Ga0157380_10311814 3300014326 Bacteria 1454
63 Ga0157380_10379587 3300014326 Bacteria 1333
64 Ga0157376_11425059 3300014969 Unclassified 725
65 Ga0207682_10205818 3300025893 Bacteria 906
66 Ga0207684_10897761 3300025910 Bacteria 745
67 Ga0207681_10140320 3300025923 Unclassified 1799
68 Ga0207681_10887075 3300025923 Bacteria 747
69 Ga0207650_10339701 3300025925 Bacteria 1233
70 Ga0207659_10758171 3300025926 Bacteria 833
71 Ga0207659_10897516 3300025926 Bacteria 762
72 Ga0207670_10092874 3300025936 Bacteria 2137
73 Ga0207704_10340678 3300025938 Unclassified 1164
74 Ga0207711_10057812 3300025941 Bacteria 3335
75 Ga0207689_10556097 3300025942 Unclassified 964
76 Ga0207703_10198587 3300026035 Bacteria 1781
77 Ga0207641_10229942 3300026088 Unclassified 1723
78 Ga0207648_10613386 3300026089 Bacteria 1004
79 Ga0207648_10822854 3300026089 Unclassified 865
80 Ga0207675_100137302 3300026118 Bacteria 2321
81 Ga0207675_100184228 3300026118 Unclassified 2000
82 Ga0207675_100185832 3300026118 Bacteria 1992
83 Ga0207675_100659125 3300026118 Bacteria 1053
84 Ga0207683_10761849 3300026121 Unclassified 898
85 Ga0207683_11028843 3300026121 Bacteria 764
86 Ga0207428_10196483 3300027907 Unclassified 1519
87 Ga0268266_10800887 3300028379 Bacteria 910
88 Ga0307408_100059045 3300031548 Unclassified 2791
89 Ga0307405_10220794 3300031731 Bacteria 1390
90 Ga0307406_10848102 3300031901 Unclassified 774
91 Ga0307407_10269655 3300031903 Bacteria 1174
92 Ga0307416_100090321 3300032002 Unclassified 2626
93 Ga0307416_102394724 3300032002 Unclassified 627
94 Ga0307416_103495337 3300032002 Unclassified 526
95 Ga0307414_11729451 3300032004 Unclassified 583
96 Ga0307411_10005216 3300032005 Bacteria 6362
97 Ga0373934_0004256 3300035086 Bacteria 5283
98 Ga0373923_0205122 3300035111 Unclassified 912
99 Ga0373936_0450578 3300035113 Unclassified 595
100 Ga0373953_0050996 3300035117 Bacteria 1672
101 Ga0373954_0017945 3300035118 Bacteria 3182
102 Ga0373956_0008078 3300035119 Bacteria 4256
103 Ga0373957_0281318 3300035120 Unclassified 703
104 Ga0373955_0014997 3300035172 Unclassified 3784
105 Ga0373933_0012433 3300035724 Bacteria 4699
106 Ga0373937_0001333 3300036401 Bacteria 20643
107 Ga0451807_1688175 3300041486 Unclassified 681
108 Ga0439435_0000434 3300042436 Bacteria 6552
109 Ga0439444_0201310 3300042437 Unclassified 502
110 Ga0495608_0469427 3300046511 Unclassified 764
111 Ga0495652_0109414 3300046529 Bacteria 2225
112 Ga0495587_0065246 3300046536 Bacteria 2126
113 Ga0495680_0216706 3300047322 Bacteria 1368
114 Ga0496100_0886151 3300048903 Unclassified 701
115 Ga0496102_1089329 3300048905 Bacteria 719
116 Ga0496103_0108687 3300048906 Bacteria 1760
117 Ga0496106_0397375 3300048909 Unclassified 1108
118 Ga0496108_0141734 3300048911 Bacteria 2071
119 Ga0496109_0348166 3300048912 Bacteria 1400
120 Ga0496110_0022428 3300048913 Bacteria 5361
121 Ga0496112_0016758 3300048915 Bacteria 6872
122 Ga0496114_0141542 3300048917 Unclassified 2083
123 Ga0501034_0068113 3300049571 Bacteria 3571
124 Ga0501036_0181012 3300049572 Unclassified 1774
125 Ga0501036_0267787 3300049572 Unclassified 1431
126 Ga0501036_0627771 3300049572 Unclassified 890
127 Ga0501040_0249101 3300049576 Bacteria 1267
128 Ga0501041_0080765 3300049577 Unclassified 2002
129 Ga0501042_0363275 3300049578 Unclassified 1048
130 Ga0501043_0180483 3300049579 Bacteria 1645
131 Ga0501048_0069899 3300049582 Unclassified 2480
132 Ga0501048_0880955 3300049582 Unclassified 644
133 Ga0501068_1043454 3300049584 Unclassified 540
134 Ga0501070_0194738 3300049586 Bacteria 1665
135 Ga0501071_0021169 3300049587 Bacteria 4529
136 Ga0501071_0166007 3300049587 Bacteria 1652
137 Ga0501072_0042562 3300049588 Bacteria 3567
138 Ga0501072_0083764 3300049588 Bacteria 2528
139 Ga0501075_0083653 3300049591 Unclassified 2417
140 Ga0501076_0034932 3300049592 Bacteria 3932
141 Ga0501258_061352 3300049687 Unclassified 544
142 Ga0501079_0049476 3300049741 Bacteria 3244
143 Ga0501080_0106795 3300049742 Bacteria 2594
144 Ga0501081_0098601 3300049743 Unclassified 2064
145 Ga0501083_0228895 3300049744 Unclassified 1211
146 Ga0501273_049969 3300049770 Unclassified 638
147 Ga0501045_0024087 3300049824 Bacteria 4369
148 nmdc:mga05p37_323384_c1 3300050507 Bacteria 1825
149 nmdc:mga05p37_3545_c1 3300050507 Bacteria 18216
150 nmdc:mga09592_1233932_c1 3300050508 Unclassified 617
151 nmdc:mga09592_38913_c1 3300050508 Bacteria 3993
152 nmdc:mga0qj67_114357_c1 3300050509 Bacteria 2180
153 nmdc:mga06r32_229648_c1 3300050510 Bacteria 1843
154 nmdc:mga06r32_35344_c1 3300050510 Bacteria 4715
155 nmdc:mga06r32_37612_c1 3300050510 Bacteria 4578
156 nmdc:mga06r32_510369_c1 3300050510 Bacteria 1179
157 nmdc:mga06r32_86396_c1 3300050510 Bacteria 3059
158 nmdc:mga08y16_100434_c1 3300050511 Bacteria 3012
159 nmdc:mga08y16_185790_c1 3300050511 Unclassified 2157
160 nmdc:mga08y16_769245_c1 3300050511 Unclassified 958
161 Ga0501084_0117937 3300054114 Unclassified 2231
162 Ga0501084_0209139 3300054114 Bacteria 1646
163 Ga0501084_0674488 3300054114 Bacteria 872
164 Ga0590075_000362 3300059424 Bacteria 12516
165 Ga0590077_004509 3300059426 Bacteria 2858
166 Ga0501082_0335326 3300060353 Bacteria 1318

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049687 Ga0501258_061352 Ga0501258_061352_62_475 122
2 3300050511 nmdc:mga08y16_769245_c1 nmdc:mga08y16_769245_c1_420_896 127
3 3300054114 Ga0501084_0117937 Ga0501084_0117937_515_910 130
4 3300005293 Ga0065715_10423892 Ga0065715_104238921 131
5 3300035113 Ga0373936_0450578 Ga0373936_0450578_173_574 132
6 3300042437 Ga0439444_0201310 Ga0439444_0201310_28_441 132
7 3300050508 nmdc:mga09592_1233932_c1 nmdc:mga09592_1233932_c1_39_449 132
8 3300025893 Ga0207682_10205818 Ga0207682_102058182 142
9 3300031548 Ga0307408_100059045 Ga0307408_1000590452 143
10 3300032002 Ga0307416_100090321 Ga0307416_1000903212 143
11 3300049770 Ga0501273_049969 Ga0501273_049969_15_491 143
12 3300049582 Ga0501048_0880955 Ga0501048_0880955_109_564 146
13 3300005841 Ga0068863_100052211 Ga0068863_1000522113 149
14 3300006358 Ga0068871_100193129 Ga0068871_1001931292 149
15 3300009177 Ga0105248_10045517 Ga0105248_100455173 149
16 3300025941 Ga0207711_10057812 Ga0207711_100578123 149
17 3300026035 Ga0207703_10198587 Ga0207703_101985872 149
18 3300026088 Ga0207641_10229942 Ga0207641_102299422 149
19 3300005290 Ga0065712_10005525 Ga0065712_100055253 151
20 3300005290 Ga0065712_10073085 Ga0065712_100730856 151
21 3300005293 Ga0065715_10024624 Ga0065715_100246243 151
22 3300005334 Ga0068869_100310967 Ga0068869_1003109672 151
23 3300005338 Ga0068868_100552650 Ga0068868_1005526502 151
24 3300005353 Ga0070669_100170503 Ga0070669_1001705031 151
25 3300005459 Ga0068867_100518891 Ga0068867_1005188912 151
26 3300005616 Ga0068852_100929525 Ga0068852_1009295252 151
27 3300005617 Ga0068859_100066102 Ga0068859_1000661024 151
28 3300006881 Ga0068865_100378514 Ga0068865_1003785141 151
29 3300006931 Ga0097620_100066105 Ga0097620_1000661052 151
30 3300009148 Ga0105243_11545703 Ga0105243_115457032 151
31 3300009177 Ga0105248_11254950 Ga0105248_112549502 151
32 3300013297 Ga0157378_10478468 Ga0157378_104784682 151
33 3300025926 Ga0207659_10897516 Ga0207659_108975161 151
34 3300025942 Ga0207689_10556097 Ga0207689_105560972 151
35 3300026089 Ga0207648_10613386 Ga0207648_106133862 151
36 3300026089 Ga0207648_10822854 Ga0207648_108228541 151
37 3300041486 Ga0451807_1688175 Ga0451807_1688175_84_545 151
38 3300048917 Ga0496114_0141542 Ga0496114_0141542_257_712 151
39 3300049588 Ga0501072_0083764 Ga0501072_0083764_532_987 151
40 3300005290 Ga0065712_10022348 Ga0065712_100223482 152
41 3300005331 Ga0070670_100277932 Ga0070670_1002779322 152
42 3300005337 Ga0070682_100334644 Ga0070682_1003346442 152
43 3300005340 Ga0070689_100065750 Ga0070689_1000657502 152
44 3300005347 Ga0070668_100314573 Ga0070668_1003145731 152
45 3300005353 Ga0070669_101132943 Ga0070669_1011329432 152
46 3300005354 Ga0070675_101393835 Ga0070675_1013938351 152
47 3300005355 Ga0070671_100845278 Ga0070671_1008452781 152
48 3300005441 Ga0070700_100566283 Ga0070700_1005662831 152
49 3300005455 Ga0070663_100760002 Ga0070663_1007600022 152
50 3300005456 Ga0070678_102131986 Ga0070678_1021319861 152
51 3300005547 Ga0070693_100098038 Ga0070693_1000980382 152
52 3300005719 Ga0068861_101064209 Ga0068861_1010642091 152
53 3300006237 Ga0097621_100067209 Ga0097621_1000672092 152
54 3300006358 Ga0068871_100415561 Ga0068871_1004155612 152
55 3300006847 Ga0075431_100177972 Ga0075431_1001779724 152
56 3300006871 Ga0075434_100903268 Ga0075434_1009032682 152
57 3300009094 Ga0111539_10077104 Ga0111539_100771042 152
58 3300009094 Ga0111539_10512603 Ga0111539_105126033 152
59 3300009148 Ga0105243_11938154 Ga0105243_119381541 152
60 3300009553 Ga0105249_12456475 Ga0105249_124564751 152
61 3300014326 Ga0157380_10014787 Ga0157380_100147874 152
62 3300014326 Ga0157380_10153068 Ga0157380_101530681 152
63 3300014326 Ga0157380_10311814 Ga0157380_103118142 152
64 3300025910 Ga0207684_10897761 Ga0207684_108977611 152
65 3300025923 Ga0207681_10140320 Ga0207681_101403202 152
66 3300025923 Ga0207681_10887075 Ga0207681_108870752 152
67 3300025925 Ga0207650_10339701 Ga0207650_103397012 152
68 3300025926 Ga0207659_10758171 Ga0207659_107581712 152
69 3300025936 Ga0207670_10092874 Ga0207670_100928743 152
70 3300026118 Ga0207675_100137302 Ga0207675_1001373022 152
71 3300026118 Ga0207675_100185832 Ga0207675_1001858323 152
72 3300026121 Ga0207683_11028843 Ga0207683_110288431 152
73 3300035086 Ga0373934_0004256 Ga0373934_0004256_4071_4532 152
74 3300035111 Ga0373923_0205122 Ga0373923_0205122_310_771 152
75 3300035117 Ga0373953_0050996 Ga0373953_0050996_291_752 152
76 3300035118 Ga0373954_0017945 Ga0373954_0017945_1624_2085 152
77 3300035119 Ga0373956_0008078 Ga0373956_0008078_654_1115 152
78 3300035120 Ga0373957_0281318 Ga0373957_0281318_189_650 152
79 3300035172 Ga0373955_0014997 Ga0373955_0014997_778_1239 152
80 3300035724 Ga0373933_0012433 Ga0373933_0012433_3983_4444 152
81 3300036401 Ga0373937_0001333 Ga0373937_0001333_13523_13984 152
82 3300046511 Ga0495608_0469427 Ga0495608_0469427_18_476 152
83 3300046529 Ga0495652_0109414 Ga0495652_0109414_860_1321 152
84 3300046536 Ga0495587_0065246 Ga0495587_0065246_1175_1636 152
85 3300047322 Ga0495680_0216706 Ga0495680_0216706_799_1260 152
86 3300049571 Ga0501034_0068113 Ga0501034_0068113_1926_2384 152
87 3300049576 Ga0501040_0249101 Ga0501040_0249101_35_496 152
88 3300049579 Ga0501043_0180483 Ga0501043_0180483_845_1348 152
89 3300049586 Ga0501070_0194738 Ga0501070_0194738_1029_1487 152
90 3300050510 nmdc:mga06r32_37612_c1 nmdc:mga06r32_37612_c1_1618_2094 152
91 3300050511 nmdc:mga08y16_100434_c1 nmdc:mga08y16_100434_c1_811_1269 152
92 3300050511 nmdc:mga08y16_185790_c1 nmdc:mga08y16_185790_c1_112_576 152
93 3300060353 Ga0501082_0335326 Ga0501082_0335326_485_946 152
94 3300002239 JGI24034J26672_10017737 JGI24034J26672_100177371 153
95 3300005333 Ga0070677_10199885 Ga0070677_101998851 153
96 3300005356 Ga0070674_100009971 Ga0070674_1000099715 153
97 3300005364 Ga0070673_101055729 Ga0070673_1010557291 153
98 3300005543 Ga0070672_100795754 Ga0070672_1007957541 153
99 3300005543 Ga0070672_101377136 Ga0070672_1013771361 153
100 3300005548 Ga0070665_100293909 Ga0070665_1002939093 153
101 3300005718 Ga0068866_10567347 Ga0068866_105673471 153
102 3300005844 Ga0068862_100718806 Ga0068862_1007188062 153
103 3300006844 Ga0075428_100274599 Ga0075428_1002745993 153
104 3300006844 Ga0075428_101613937 Ga0075428_1016139371 153
105 3300006846 Ga0075430_100009691 Ga0075430_1000096911 153
106 3300006846 Ga0075430_100538966 Ga0075430_1005389661 153
107 3300006847 Ga0075431_100038286 Ga0075431_1000382867 153
108 3300006847 Ga0075431_100103102 Ga0075431_1001031024 153
109 3300006880 Ga0075429_100097366 Ga0075429_1000973664 153
110 3300006881 Ga0068865_101222924 Ga0068865_1012229241 153
111 3300009147 Ga0114129_10012984 Ga0114129_1001298411 153
112 3300009147 Ga0114129_10078261 Ga0114129_100782612 153
113 3300013297 Ga0157378_10610326 Ga0157378_106103262 153
114 3300014326 Ga0157380_10379587 Ga0157380_103795872 153
115 3300014969 Ga0157376_11425059 Ga0157376_114250591 153
116 3300025938 Ga0207704_10340678 Ga0207704_103406782 153
117 3300026118 Ga0207675_100184228 Ga0207675_1001842283 153
118 3300026118 Ga0207675_100659125 Ga0207675_1006591252 153
119 3300026121 Ga0207683_10761849 Ga0207683_107618492 153
120 3300027907 Ga0207428_10196483 Ga0207428_101964832 153
121 3300028379 Ga0268266_10800887 Ga0268266_108008871 153
122 3300031731 Ga0307405_10220794 Ga0307405_102207942 153
123 3300031901 Ga0307406_10848102 Ga0307406_108481021 153
124 3300031903 Ga0307407_10269655 Ga0307407_102696552 153
125 3300032002 Ga0307416_102394724 Ga0307416_1023947242 153
126 3300032002 Ga0307416_103495337 Ga0307416_1034953371 153
127 3300032004 Ga0307414_11729451 Ga0307414_117294511 153
128 3300032005 Ga0307411_10005216 Ga0307411_100052161 153
129 3300042436 Ga0439435_0000434 Ga0439435_0000434_4399_4875 153
130 3300048903 Ga0496100_0886151 Ga0496100_0886151_60_554 153
131 3300048905 Ga0496102_1089329 Ga0496102_1089329_208_672 153
132 3300048906 Ga0496103_0108687 Ga0496103_0108687_494_988 153
133 3300048909 Ga0496106_0397375 Ga0496106_0397375_345_839 153
134 3300048911 Ga0496108_0141734 Ga0496108_0141734_1479_1973 153
135 3300048912 Ga0496109_0348166 Ga0496109_0348166_431_925 153
136 3300048913 Ga0496110_0022428 Ga0496110_0022428_2390_2884 153
137 3300048915 Ga0496112_0016758 Ga0496112_0016758_888_1382 153
138 3300049572 Ga0501036_0181012 Ga0501036_0181012_846_1313 153
139 3300049572 Ga0501036_0267787 Ga0501036_0267787_197_673 153
140 3300049572 Ga0501036_0627771 Ga0501036_0627771_43_507 153
141 3300049577 Ga0501041_0080765 Ga0501041_0080765_1453_1920 153
142 3300049578 Ga0501042_0363275 Ga0501042_0363275_162_626 153
143 3300049582 Ga0501048_0069899 Ga0501048_0069899_198_665 153
144 3300049584 Ga0501068_1043454 Ga0501068_1043454_24_491 153
145 3300049587 Ga0501071_0021169 Ga0501071_0021169_3287_3754 153
146 3300049587 Ga0501071_0166007 Ga0501071_0166007_716_1180 153
147 3300049588 Ga0501072_0042562 Ga0501072_0042562_2866_3333 153
148 3300049591 Ga0501075_0083653 Ga0501075_0083653_1469_1936 153
149 3300049592 Ga0501076_0034932 Ga0501076_0034932_2444_2911 153
150 3300049741 Ga0501079_0049476 Ga0501079_0049476_2733_3200 153
151 3300049742 Ga0501080_0106795 Ga0501080_0106795_1833_2300 153
152 3300049743 Ga0501081_0098601 Ga0501081_0098601_1065_1532 153
153 3300049744 Ga0501083_0228895 Ga0501083_0228895_675_1142 153
154 3300049824 Ga0501045_0024087 Ga0501045_0024087_952_1419 153
155 3300050507 nmdc:mga05p37_323384_c1 nmdc:mga05p37_323384_c1_1217_1687 153
156 3300050507 nmdc:mga05p37_3545_c1 nmdc:mga05p37_3545_c1_7764_8249 153
157 3300050508 nmdc:mga09592_38913_c1 nmdc:mga09592_38913_c1_145_615 153
158 3300050509 nmdc:mga0qj67_114357_c1 nmdc:mga0qj67_114357_c1_919_1389 153
159 3300050510 nmdc:mga06r32_229648_c1 nmdc:mga06r32_229648_c1_1002_1475 153
160 3300050510 nmdc:mga06r32_35344_c1 nmdc:mga06r32_35344_c1_89_562 153
161 3300050510 nmdc:mga06r32_510369_c1 nmdc:mga06r32_510369_c1_656_1126 153
162 3300050510 nmdc:mga06r32_86396_c1 nmdc:mga06r32_86396_c1_2039_2506 153
163 3300054114 Ga0501084_0209139 Ga0501084_0209139_1076_1543 153
164 3300054114 Ga0501084_0674488 Ga0501084_0674488_382_855 153
165 3300059424 Ga0590075_000362 Ga0590075_000362_4664_5158 153
166 3300059426 Ga0590077_004509 Ga0590077_004509_2276_2770 153

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

28

155

0.98

PF08534

Redoxin

Redoxin

27

173

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5id2-assembly1.cif.gz_B asymmetry in the active site of mycobacterium tuberculosis ahpe upon exposure to mycothiol 0.9399 1 153
5zte-assembly2.cif.gz_F crystal structure of prxa c119s mutant from arabidopsis thaliana 0.9376 3 152
5c04-assembly1.cif.gz_B crystal structure of the f37h mutant ahpe from mycobacterium tuberculosis 0.9347 1 153
4xih-assembly1.cif.gz_B-2 crystal structure of the r116a mutant ahpe from mycobacterium tuberculosis 0.9344 1 153
1xvw-assembly1.cif.gz_B crystal structure of ahpe from mycobacterium tuberculosis, a 1-cys peroxiredoxin 0.9341 2 152
ID Description Score Start End Superfamily
af_A0A0R4J2P7_61_260_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9414 3 152 3.40.30.10
5id2B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9399 1 153 3.40.30.10
af_P9WQB7_4_193_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9396 3 152 3.40.30.10
5id2B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.934 1 153 3.40.30.10
af_Q8I5Q6_15_214_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9279 3 152 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7C5B493-F1-model_v4 Redoxin domain-containing protein 0.9718 1 151 GO:0016209
GO:0016491
AF-A0A432HZV7-F1-model_v4 Peroxiredoxin 0.9698 1 151 GO:0016209
GO:0016491
AF-A0A661K3L0-F1-model_v4 Peroxiredoxin 0.9679 2 152 GO:0016209
GO:0016491
AF-A0A1F9CY79-F1-model_v4 Alkyl hydroperoxide reductase 0.9678 3 150 GO:0016209
GO:0016491
AF-A0A1J5MW39-F1-model_v4 Putative peroxiredoxin (EC 1.11.1.15) 0.9673 3 152 GO:0004601

Feature Viewer

pLDDT pTM Quality
89.06 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map