F248533

General Info

Members Datasets Scaffolds Average Seq Length
166 147 149 318

Family's Representative Sequence

Representative Sequence 3300025928|Ga0207700_10248794|Ga0207700_102487941
Length 306
Sequence MTHVPGGTFRMGSDHHYPEEAPSHLVTVDEFWIDSTPVTNRQFAEFVRDTGHVTFAEIIPDPKDYPGSLPHMIFAGSLVFTPPKHQVDLRDWSQWWTLLKGANWRQPYGPGSSIKGRDHHPVVHVSFGDALAYATWKGKELPTEAEWEFAARGGLDGAEFAWGAEFMPRGRAMANTWHGEFPHRRRPGHRRTSPVRAFPPNGYGLYDMIGNVWEWTTDWWSVKHVADEPKACCVPTNPRGGPEAASYDPQLPDIKIPRKVIKGGSHLCAPNYCRRYRPAARHAEPVDTSTSHVGFRCIVREIGTAS

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
4 2738543024 Aminobacter sp. AP02 Isolate Unclassified
5 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
6 2906610324
7 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
8 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
9 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
10 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
11 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
57 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
77 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
78 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
79 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
80 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
81 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
89 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
90 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
91 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
92 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
93 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
94 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
95 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
96 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
97 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
98 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
99 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
100 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
101 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
102 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
103 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
104 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
105 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
106 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
107 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
108 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
109 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
110 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
111 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
112 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
113 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
114 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
115 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
116 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
117 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
118 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
119 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
120 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
121 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
122 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
123 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
124 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
125 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
128 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
129 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
130 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
131 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
132 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
133 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
134 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
135 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
136 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
137 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
138 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
139 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
140 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
141 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
142 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
143 641522639 Methylobacterium sp. 4-46 Isolate Nodule
144 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
145 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
146 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
147 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.3
Metatranscriptomes 0
Isolates 9.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.66
Nodule 7.83
Rhizoplane 2.41
Rhizosphere 66.87
Stem 0
Stem Tuber 0
Unclassified 7.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100037165 3300005329 Bacteria 4457
2 Ga0070661_100126141 3300005344 Bacteria 1920
3 Ga0070675_100106623 3300005354 Bacteria 2365
4 Ga0070674_100038547 3300005356 Bacteria 3221
5 Ga0070709_10068491 3300005434 Bacteria 2282
6 Ga0070713_100284829 3300005436 Bacteria 1517
7 Ga0070711_100139334 3300005439 Bacteria 1817
8 Ga0070678_100020906 3300005456 Bacteria 4303
9 Ga0070681_10067409 3300005458 Bacteria 3547
10 Ga0068867_100001391 3300005459 Bacteria 16731
11 Ga0070706_100406774 3300005467 Bacteria 1267
12 Ga0070679_100047792 3300005530 Bacteria 4264
13 Ga0070697_100057476 3300005536 Bacteria 3165
14 Ga0070665_100007728 3300005548 Bacteria 10915
15 Ga0070665_100048992 3300005548 Bacteria 4240
16 Ga0070664_100103934 3300005564 Bacteria 2473
17 Ga0068856_100014431 3300005614 Bacteria 7630
18 Ga0068852_100064038 3300005616 Bacteria 3203
19 Ga0068860_100224001 3300005843 Bacteria 1826
20 Ga0068862_100163962 3300005844 Bacteria 1985
21 Ga0081455_10052914 3300005937 Bacteria 3472
22 Ga0081540_1000485 3300005983 Bacteria 38990
23 Ga0081539_10008890 3300005985 Bacteria 8577
24 Ga0075365_10172639 3300006038 Bacteria 1509
25 Ga0075364_10002451 3300006051 Bacteria 10391
26 Ga0075362_10023198 3300006177 Bacteria 2623
27 Ga0075362_10046162 3300006177 Bacteria 1937
28 Ga0075367_10055525 3300006178 Bacteria 2351
29 Ga0075367_10118098 3300006178 Bacteria 1632
30 Ga0075366_10059000 3300006195 Bacteria 2279
31 Ga0075370_10030713 3300006353 Bacteria 2998
32 Ga0099794_10015795 3300007265 Bacteria 3339
33 Ga0105244_10009085 3300009036 Bacteria 6138
34 Ga0105243_10038045 3300009148 Bacteria 3745
35 Ga0105241_10231225 3300009174 Bacteria 1559
36 Ga0105242_10231181 3300009176 Bacteria 1657
37 Ga0105238_10127345 3300009551 Bacteria 2525
38 Ga0105249_10139185 3300009553 Bacteria 2325
39 Ga0157371_10067517 3300013102 Bacteria 2531
40 Ga0157369_10059665 3300013105 Bacteria 4114
41 Ga0157369_10099569 3300013105 Bacteria 3099
42 Ga0157374_10119339 3300013296 Bacteria 2544
43 Ga0157378_10101509 3300013297 Bacteria 2627
44 Ga0163162_10028466 3300013306 Bacteria 5529
45 Ga0157372_10119012 3300013307 Bacteria 3031
46 Ga0157372_10420603 3300013307 Bacteria 1557
47 Ga0157380_10104849 3300014326 Bacteria 2362
48 Ga0182008_10021341 3300014497 Bacteria 3325
49 Ga0182008_10069588 3300014497 Bacteria 1731
50 Ga0157379_10380121 3300014968 Bacteria 1296
51 Ga0209758_1010340 3300025297 Bacteria 5600
52 Ga0207655_1005167 3300025728 Bacteria 8981
53 Ga0207692_10101913 3300025898 Bacteria 1578
54 Ga0207699_10123430 3300025906 Bacteria 1678
55 Ga0207645_10103201 3300025907 Bacteria 1841
56 Ga0207684_10337410 3300025910 Bacteria 1298
57 Ga0207707_10041187 3300025912 Bacteria 4034
58 Ga0207681_10159612 3300025923 Bacteria 1698
59 Ga0207687_10043426 3300025927 Bacteria 3097
60 Ga0207700_10248794 3300025928 Bacteria 1518
61 Ga0207669_10070550 3300025937 Bacteria 2191
62 Ga0207661_10009116 3300025944 Bacteria 7112
63 Ga0207661_10134041 3300025944 Bacteria 2125
64 Ga0207679_10028732 3300025945 Bacteria 3863
65 Ga0207667_10048709 3300025949 Bacteria 4479
66 Ga0207702_10030100 3300026078 Bacteria 4522
67 Ga0207648_10003383 3300026089 Bacteria 16757
68 Ga0207675_100002924 3300026118 Bacteria 16801
69 Ga0207683_10021272 3300026121 Bacteria 5551
70 Ga0268266_10009176 3300028379 Bacteria 8730
71 Ga0268266_10023453 3300028379 Bacteria 5255
72 Ga0268266_10114968 3300028379 Bacteria 2388
73 Ga0268265_10028972 3300028380 Bacteria 3970
74 Ga0307517_10038454 3300028786 Bacteria 5296
75 Ga0316576_10030862 3300031727 Bacteria 3798
76 Ga0316577_10205781 3300031733 Bacteria 1112
77 Ga0373941_0113578 3300035115 Bacteria 957
78 Ga0373927_0093690 3300035695 Bacteria 1951
79 Ga0373937_0516274 3300036401 Bacteria 1135
80 Ga0373925_0192757 3300037068 Bacteria 1618
81 Ga0395899_0188879 3300037312 Bacteria 1442
82 Ga0395900_0052472 3300037418 Bacteria 4197
83 Ga0395905_0019561 3300037471 Bacteria 6418
84 Ga0436364_0804513 3300037853 Bacteria 3918
85 Ga0395901_0008864 3300038443 Bacteria 10185
86 Ga0436361_0261180 3300039447 Bacteria 1656
87 Ga0451576_0008777 3300045051 Bacteria 11824
88 Ga0466967_0046582 3300045976 Bacteria 3776
89 Ga0495651_0146257 3300046462 Bacteria 1708
90 Ga0495583_0048340 3300046506 Bacteria 1953
91 Ga0495606_0000831 3300046507 Bacteria 46699
92 Ga0495608_0059690 3300046511 Bacteria 2512
93 Ga0495618_0223544 3300046514 Bacteria 1187
94 Ga0495632_0036615 3300046519 Bacteria 2495
95 Ga0495648_0023722 3300046524 Bacteria 4193
96 Ga0495652_0045502 3300046529 Bacteria 3772
97 Ga0495640_0217971 3300046533 Bacteria 1204
98 Ga0495645_0184619 3300046543 Bacteria 1426
99 Ga0495668_0191813 3300046616 Bacteria 1119
100 Ga0495634_0085880 3300046642 Bacteria 2050
101 Ga0495625_0007400 3300046660 Bacteria 9566
102 Ga0495659_0040217 3300046664 Bacteria 1665
103 Ga0495657_0036269 3300046675 Bacteria 3409
104 Ga0495624_0054544 3300046690 Bacteria 2519
105 Ga0495670_0003645 3300046691 Bacteria 7570
106 Ga0495671_0048898 3300046692 Bacteria 2109
107 Ga0495600_0056511 3300046809 Bacteria 2564
108 Ga0495604_0155493 3300047317 Bacteria 1620
109 Ga0495636_0000329 3300047318 Bacteria 18158
110 Ga0495636_0001710 3300047318 Bacteria 8373
111 Ga0495674_0225699 3300047319 Bacteria 1547
112 Ga0495680_0030393 3300047322 Bacteria 4411
113 Ga0495685_032378 3300047447 Bacteria 1796
114 Ga0495602_0116488 3300048088 Bacteria 2158
115 Ga0496105_0101059 3300048908 Bacteria 2381
116 Ga0496106_0098110 3300048909 Bacteria 2269
117 Ga0496106_0169555 3300048909 Bacteria 1729
118 Ga0496115_0082009 3300048918 Bacteria 2627
119 Ga0496117_0026313 3300048920 Bacteria 4554
120 Ga0496118_0016285 3300048921 Bacteria 6827
121 Ga0496118_0142908 3300048921 Bacteria 1513
122 Ga0496118_0240726 3300048921 Bacteria 1036
123 Ga0496121_0002406 3300048924 Bacteria 28672
124 Ga0496121_0126837 3300048924 Bacteria 1917
125 Ga0496124_0038991 3300048927 Bacteria 4121
126 Ga0496125_0062952 3300048928 Bacteria 2961
127 Ga0495682_0005925 3300049460 Bacteria 5013
128 Ga0501034_0121620 3300049571 Bacteria 2597
129 Ga0501034_0553820 3300049571 Bacteria 1059
130 Ga0501047_0376553 3300049581 Bacteria 1254
131 Ga0501083_0011167 3300049744 Bacteria 6303
132 Ga0501044_0262841 3300049823 Bacteria 1664
133 nmdc:mga03683_13858_c1 3300050489 Bacteria 2973
134 nmdc:mga03683_26446_c1 3300050489 Bacteria 2289
135 nmdc:mga00v17_791_c3 3300050491 Bacteria 6171
136 nmdc:mga0yw44_17879_c1 3300050492 Bacteria 3870
137 nmdc:mga0yw44_192850_c1 3300050492 Bacteria 1344
138 nmdc:mga0k408_64722_c1 3300050493 Bacteria 2128
139 nmdc:mga06z11_159535_c1 3300050494 Bacteria 1288
140 nmdc:mga06z11_17162_c1 3300050494 Bacteria 3279
141 nmdc:mga07m45_17362_c2 3300050496 Bacteria 3542
142 nmdc:mga0sz30_51294_c1 3300050516 Bacteria 1750
143 Ga0500581_006712 3300053089 Bacteria 5460
144 Ga0500562_009069 3300053108 Bacteria 2514
145 Ga0500608_024678 3300053122 Bacteria 2809
146 Ga0500642_0000030 3300053130 Bacteria 115114
147 Ga0500658_0045746 3300053134 Bacteria 1770
148 Ga0500616_0000459 3300053153 Bacteria 53223
149 Ga0500633_0051565 3300053160 Bacteria 1421

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048921 Ga0496118_0240726 Ga0496118_0240726_167_1012 281
2 3300050494 nmdc:mga06z11_17162_c1 nmdc:mga06z11_17162_c1_2401_3246 281
3 3300045051 Ga0451576_0008777 Ga0451576_0008777_10904_11797 293
4 iso_pu_bacteria 2883354860 2883357456 293
5 3300014968 Ga0157379_10380121 Ga0157379_103801211 294
6 3300035115 Ga0373941_0113578 Ga0373941_0113578_18_908 296
7 3300046533 Ga0495640_0217971 Ga0495640_0217971_17_907 296
8 3300048921 Ga0496118_0016285 Ga0496118_0016285_10_906 296
9 3300035695 Ga0373927_0093690 Ga0373927_0093690_1039_1932 297
10 3300046642 Ga0495634_0085880 Ga0495634_0085880_19_912 297
11 3300046690 Ga0495624_0054544 Ga0495624_0054544_1608_2501 297
12 3300049571 Ga0501034_0553820 Ga0501034_0553820_63_956 297
13 3300046514 Ga0495618_0223544 Ga0495618_0223544_17_913 298
14 iso_pu_bacteria 2508501114 2509079449 299
15 3300005983 Ga0081540_1000485 Ga0081540_10004858 300
16 3300006178 Ga0075367_10118098 Ga0075367_101180981 300
17 3300048924 Ga0496121_0126837 Ga0496121_0126837_33_944 303
18 iso_pu_bacteria 641522639 641646832 303
19 3300025937 Ga0207669_10070550 Ga0207669_100705502 304
20 3300026121 Ga0207683_10021272 Ga0207683_100212722 304
21 3300031727 Ga0316576_10030862 Ga0316576_100308622 304
22 3300031733 Ga0316577_10205781 Ga0316577_102057811 304
23 3300005436 Ga0070713_100284829 Ga0070713_1002848292 306
24 3300005548 Ga0070665_100048992 Ga0070665_1000489925 306
25 3300006051 Ga0075364_10002451 Ga0075364_100024516 306
26 3300006178 Ga0075367_10055525 Ga0075367_100555252 306
27 3300006353 Ga0075370_10030713 Ga0075370_100307132 306
28 3300025928 Ga0207700_10248794 Ga0207700_102487941 306
29 3300028379 Ga0268266_10023453 Ga0268266_100234532 306
30 3300046506 Ga0495583_0048340 Ga0495583_0048340_361_1287 306
31 3300046524 Ga0495648_0023722 Ga0495648_0023722_2094_3020 306
32 3300046616 Ga0495668_0191813 Ga0495668_0191813_128_1054 306
33 3300046660 Ga0495625_0007400 Ga0495625_0007400_5189_6115 306
34 3300046691 Ga0495670_0003645 Ga0495670_0003645_999_1925 306
35 3300046692 Ga0495671_0048898 Ga0495671_0048898_119_1045 306
36 3300048088 Ga0495602_0116488 Ga0495602_0116488_57_977 306
37 3300048909 Ga0496106_0098110 Ga0496106_0098110_1242_2168 306
38 3300048920 Ga0496117_0026313 Ga0496117_0026313_414_1340 306
39 3300048921 Ga0496118_0142908 Ga0496118_0142908_501_1427 306
40 3300048924 Ga0496121_0002406 Ga0496121_0002406_21856_22782 306
41 3300048927 Ga0496124_0038991 Ga0496124_0038991_1472_2398 306
42 3300048928 Ga0496125_0062952 Ga0496125_0062952_1289_2215 306
43 3300050491 nmdc:mga00v17_791_c3 nmdc:mga00v17_791_c3_1090_2016 306
44 3300050492 nmdc:mga0yw44_17879_c1 nmdc:mga0yw44_17879_c1_2507_3433 306
45 3300050494 nmdc:mga06z11_159535_c1 nmdc:mga06z11_159535_c1_197_1123 306
46 3300050496 nmdc:mga07m45_17362_c2 nmdc:mga07m45_17362_c2_216_1142 306
47 3300050516 nmdc:mga0sz30_51294_c1 nmdc:mga0sz30_51294_c1_774_1700 306
48 3300053108 Ga0500562_009069 Ga0500562_009069_81_1007 306
49 3300053130 Ga0500642_0000030 Ga0500642_0000030_10434_11360 306
50 3300053160 Ga0500633_0051565 Ga0500633_0051565_425_1351 306
51 3300048909 Ga0496106_0169555 Ga0496106_0169555_775_1698 307
52 3300006177 Ga0075362_10023198 Ga0075362_100231982 313
53 3300009176 Ga0105242_10231181 Ga0105242_102311811 313
54 3300050489 nmdc:mga03683_13858_c1 nmdc:mga03683_13858_c1_616_1557 313
55 iso_pu_bacteria 2738543024 2739308513 313
56 3300005459 Ga0068867_100001391 Ga0068867_1000013918 314
57 3300005548 Ga0070665_100007728 Ga0070665_1000077286 314
58 3300013297 Ga0157378_10101509 Ga0157378_101015093 314
59 3300014326 Ga0157380_10104849 Ga0157380_101048492 314
60 3300026089 Ga0207648_10003383 Ga0207648_100033839 314
61 3300026118 Ga0207675_100002924 Ga0207675_10000292414 314
62 3300028379 Ga0268266_10009176 Ga0268266_100091767 314
63 3300036401 Ga0373937_0516274 Ga0373937_0516274_94_1038 314
64 3300048918 Ga0496115_0082009 Ga0496115_0082009_495_1439 314
65 iso_pu_bacteria 2582581305 2585264144 316
66 3300005937 Ga0081455_10052914 Ga0081455_100529141 317
67 3300006177 Ga0075362_10046162 Ga0075362_100461622 317
68 3300006195 Ga0075366_10059000 Ga0075366_100590002 317
69 3300028379 Ga0268266_10114968 Ga0268266_101149682 317
70 3300050489 nmdc:mga03683_26446_c1 nmdc:mga03683_26446_c1_1046_1999 317
71 3300050493 nmdc:mga0k408_64722_c1 nmdc:mga0k408_64722_c1_422_1375 317
72 3300005356 Ga0070674_100038547 Ga0070674_1000385473 318
73 3300005456 Ga0070678_100020906 Ga0070678_1000209064 318
74 3300013296 Ga0157374_10119339 Ga0157374_101193392 318
75 3300037068 Ga0373925_0192757 Ga0373925_0192757_634_1590 318
76 3300053153 Ga0500616_0000459 Ga0500616_0000459_13519_14475 318
77 3300005985 Ga0081539_10008890 Ga0081539_100088904 319
78 3300045976 Ga0466967_0046582 Ga0466967_0046582_64_1023 319
79 3300005344 Ga0070661_100126141 Ga0070661_1001261412 320
80 3300005564 Ga0070664_100103934 Ga0070664_1001039343 320
81 3300005614 Ga0068856_100014431 Ga0068856_1000144313 320
82 3300005616 Ga0068852_100064038 Ga0068852_1000640383 320
83 3300009036 Ga0105244_10009085 Ga0105244_100090853 320
84 3300009174 Ga0105241_10231225 Ga0105241_102312252 320
85 3300009551 Ga0105238_10127345 Ga0105238_101273452 320
86 3300013102 Ga0157371_10067517 Ga0157371_100675172 320
87 3300013105 Ga0157369_10059665 Ga0157369_100596653 320
88 3300013307 Ga0157372_10119012 Ga0157372_101190123 320
89 3300014497 Ga0182008_10069588 Ga0182008_100695883 320
90 3300025728 Ga0207655_1005167 Ga0207655_10051675 320
91 3300025907 Ga0207645_10103201 Ga0207645_101032012 320
92 3300025944 Ga0207661_10134041 Ga0207661_101340412 320
93 3300025945 Ga0207679_10028732 Ga0207679_100287323 320
94 3300025949 Ga0207667_10048709 Ga0207667_100487093 320
95 3300026078 Ga0207702_10030100 Ga0207702_100301003 320
96 3300037312 Ga0395899_0188879 Ga0395899_0188879_441_1403 320
97 3300038443 Ga0395901_0008864 Ga0395901_0008864_5998_6960 320
98 3300049571 Ga0501034_0121620 Ga0501034_0121620_546_1508 320
99 iso_pu_bacteria 2906610324 2906615735 320
100 iso_pu_bacteria 2935769743 2935774529 320
101 iso_pu_bacteria 2935777560 2935781820 320
102 iso_pu_bacteria 2935785616 2935789456 320
103 iso_pu_bacteria 2935793552 2935797501 320
104 iso_pu_bacteria 8016603502 8016604726 320
105 iso_pu_bacteria 8016613128 8016620286 320
106 iso_pu_bacteria 8019538911 8019539134 320
107 iso_pu_bacteria 2508501050 2508734975 321
108 3300005354 Ga0070675_100106623 Ga0070675_1001066233 322
109 3300025923 Ga0207681_10159612 Ga0207681_101596122 322
110 3300005844 Ga0068862_100163962 Ga0068862_1001639622 323
111 3300006038 Ga0075365_10172639 Ga0075365_101726392 323
112 3300046664 Ga0495659_0040217 Ga0495659_0040217_186_1160 323
113 3300047318 Ga0495636_0000329 Ga0495636_0000329_9108_10082 323
114 3300047318 Ga0495636_0001710 Ga0495636_0001710_3210_4184 323
115 3300047447 Ga0495685_032378 Ga0495685_032378_494_1468 323
116 3300050492 nmdc:mga0yw44_192850_c1 nmdc:mga0yw44_192850_c1_232_1203 323
117 iso_pu_bacteria 2508501114 2509078651 323
118 iso_pu_bacteria 2932801729 2932803878 323
119 3300039447 Ga0436361_0261180 Ga0436361_0261180_14_1000 324
120 3300053122 Ga0500608_024678 Ga0500608_024678_925_1905 324
121 iso_pu_bacteria 8005563573 8005563729 324
122 3300009148 Ga0105243_10038045 Ga0105243_100380454 325
123 3300049744 Ga0501083_0011167 Ga0501083_0011167_5014_5991 325
124 3300013306 Ga0163162_10028466 Ga0163162_100284661 326
125 3300009553 Ga0105249_10139185 Ga0105249_101391853 327
126 3300025898 Ga0207692_10101913 Ga0207692_101019132 327
127 3300028380 Ga0268265_10028972 Ga0268265_100289723 327
128 3300025297 Ga0209758_1010340 Ga0209758_10103405 328
129 3300046462 Ga0495651_0146257 Ga0495651_0146257_298_1284 328
130 3300046507 Ga0495606_0000831 Ga0495606_0000831_18423_19409 328
131 3300046511 Ga0495608_0059690 Ga0495608_0059690_1294_2280 328
132 3300046529 Ga0495652_0045502 Ga0495652_0045502_1595_2581 328
133 3300046543 Ga0495645_0184619 Ga0495645_0184619_340_1326 328
134 3300046675 Ga0495657_0036269 Ga0495657_0036269_343_1329 328
135 3300046809 Ga0495600_0056511 Ga0495600_0056511_556_1542 328
136 3300047317 Ga0495604_0155493 Ga0495604_0155493_474_1460 328
137 3300047319 Ga0495674_0225699 Ga0495674_0225699_113_1099 328
138 3300047322 Ga0495680_0030393 Ga0495680_0030393_3331_4317 328
139 3300053089 Ga0500581_006712 Ga0500581_006712_1813_2805 328
140 3300014497 Ga0182008_10021341 Ga0182008_100213412 329
141 3300049823 Ga0501044_0262841 Ga0501044_0262841_375_1376 329
142 3300037853 Ga0436364_0804513 Ga0436364_0804513_544_1536 330
143 3300049581 Ga0501047_0376553 Ga0501047_0376553_70_1074 330
144 3300005439 Ga0070711_100139334 Ga0070711_1001393341 331
145 3300005843 Ga0068860_100224001 Ga0068860_1002240011 331
146 3300025927 Ga0207687_10043426 Ga0207687_100434263 331
147 3300048908 Ga0496105_0101059 Ga0496105_0101059_223_1221 331
148 3300005434 Ga0070709_10068491 Ga0070709_100684912 332
149 3300005467 Ga0070706_100406774 Ga0070706_1004067741 332
150 3300005536 Ga0070697_100057476 Ga0070697_1000574763 332
151 3300007265 Ga0099794_10015795 Ga0099794_100157952 332
152 3300025906 Ga0207699_10123430 Ga0207699_101234301 332
153 3300025910 Ga0207684_10337410 Ga0207684_103374101 332
154 3300028786 Ga0307517_10038454 Ga0307517_100384544 332
155 3300037418 Ga0395900_0052472 Ga0395900_0052472_2911_3951 332
156 3300037471 Ga0395905_0019561 Ga0395905_0019561_5201_6241 332
157 3300046519 Ga0495632_0036615 Ga0495632_0036615_1233_2240 332
158 3300049460 Ga0495682_0005925 Ga0495682_0005925_2265_3272 332
159 3300053134 Ga0500658_0045746 Ga0500658_0045746_52_1059 332
160 3300005458 Ga0070681_10067409 Ga0070681_100674093 336
161 3300013105 Ga0157369_10099569 Ga0157369_100995692 336
162 3300025944 Ga0207661_10009116 Ga0207661_100091163 336
163 3300005329 Ga0070683_100037165 Ga0070683_1000371653 338
164 3300005530 Ga0070679_100047792 Ga0070679_1000477923 338
165 3300013307 Ga0157372_10420603 Ga0157372_104206032 338
166 3300025912 Ga0207707_10041187 Ga0207707_100411874 338

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03781

FGE-sulfatase

Sulfatase-modifying factor enzyme 1

1

299

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y1f-assembly1.cif.gz_X human formylglycine generating enzyme with cysteine sulfenic acid 0.9118 27 330
2aii-assembly1.cif.gz_X wild-type formylglycine generating enzyme reacted with iodoacetamide 0.9111 27 330
2afy-assembly1.cif.gz_X formylglycine generating enzyme c341s mutant 0.9111 27 330
2hib-assembly1.cif.gz_X human formylglycine generating enzyme, c336s mutant, iodide co-crystallization 0.9092 27 330
1z70-assembly1.cif.gz_X 1.15a resolution structure of the formylglycine generating enzyme fge 0.9089 27 330
ID Description Score Start End Superfamily
af_I6Y8I5_2_297_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.9082 27 330 3.90.1580.10
af_I6Y8I5_2_297_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.8962 27 330 3.90.1580.10
af_A0A2R8Q5G7_74_369_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.8385 9 330 3.90.1580.10
af_A0A2R8Q5G7_74_369_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.8358 9 330 3.90.1580.10
af_Q8NBJ7_27_294_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.834 26 329 3.90.1580.10
ID Description Score Start End GO Terms
AF-A0A3D4Z412-F1-model_v4 Gliding motility-associated lipoprotein GldK 0.9841 27 173 GO:0120147
AF-A0A2E2T4C8-F1-model_v4 Sulfatase-modifying factor 1 0.9787 37 178 GO:0120147
AF-A0A554TVS7-F1-model_v4 deleted 0.9772 27 240
AF-A0A7W0UZR3-F1-model_v4 SUMF1/EgtB/PvdO family nonheme iron enzyme 0.9762 27 176 GO:0120147
AF-A0A2A2RFY7-F1-model_v4 Sulfatase-modifying factor protein 0.9734 27 247 GO:0120147

Feature Viewer

pLDDT pTM Quality
80.83 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map