F248331

General Info

Members Datasets Scaffolds Average Seq Length
166 120 163 271

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10003435|Ga0105237_1000343514
Length 314
Sequence MKIWKYALMSIAVVLAACNSKDQLSDASGTFEADEVIISSEVPGKILSLNLEEGSSLKKDSVVGIIDPVPLQLQKAQVEATMGALHQKTMDVKPQVKLLQDQTEILKVQLINAFYERARVQNLIKADAATTKQLDDIDLQIHVLKRQIAANKQQIKVQETTTGTQNKSVLSEYQPLKKSVAQIDDQLSRTRIVNPINGTVLSKYAMAGEITAAGKALYKIADLSVITLRAYITETQLSQIKLNESVKVLVDNGSKSYKEYPGVITMIADKAEFTPKTIQTKDERANLVYAIKVHVKNDGLLKIGMYGEIKFDAR

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2738541283 Pedobacter sp. OK701 Isolate Unclassified
3 2738543023 Pedobacter sp. OK628 Isolate Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
53 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
54 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
84 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
85 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
86 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
87 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
88 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
89 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
90 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
91 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
92 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
93 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
96 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
100 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
101 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
102 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
103 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
111 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
112 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
114 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
115 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
116 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
117 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
118 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
119 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
120 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.19
Metatranscriptomes 0
Isolates 1.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.43
Nodule 0
Rhizoplane 0
Rhizosphere 84.94
Stem 0
Stem Tuber 0
Unclassified 6.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10007492 3300003320 Bacteria 31313
2 rootL2_10357314 3300003322 Bacteria 1787
3 rootH1_10011906 3300003323 Bacteria 17140
4 Ga0055536_1003713 3300003781 Bacteria 8097
5 Ga0065165_1000501 3300005262 Bacteria 60618
6 Ga0070676_10023370 3300005328 Bacteria 3474
7 Ga0070676_10129985 3300005328 Bacteria 1591
8 Ga0070670_100139406 3300005331 Bacteria 2097
9 Ga0070677_10077700 3300005333 Bacteria 1412
10 Ga0068868_100091456 3300005338 Bacteria 2452
11 Ga0070689_100038045 3300005340 Bacteria 3680
12 Ga0070687_100054243 3300005343 Bacteria 2088
13 Ga0070674_100009916 3300005356 Bacteria 5733
14 Ga0070673_100217446 3300005364 Bacteria 1652
15 Ga0070678_100016352 3300005456 Bacteria 4744
16 Ga0068867_100297137 3300005459 Bacteria 1330
17 Ga0070698_100179171 3300005471 Bacteria 2058
18 Ga0070684_100047650 3300005535 Bacteria 3714
19 Ga0070672_100064800 3300005543 Bacteria 2888
20 Ga0070664_100052458 3300005564 Bacteria 3455
21 Ga0068857_100526179 3300005577 Bacteria 1112
22 Ga0068856_100000351 3300005614 Bacteria 50364
23 Ga0068856_100005837 3300005614 Bacteria 12133
24 Ga0068856_100058841 3300005614 Bacteria 3796
25 Ga0070702_100020388 3300005615 Bacteria 3472
26 Ga0068859_100015989 3300005617 Bacteria 7542
27 Ga0068859_100107412 3300005617 Bacteria 2851
28 Ga0068859_100252276 3300005617 Bacteria 1855
29 Ga0068859_100260828 3300005617 Unclassified 1824
30 Ga0068864_100587381 3300005618 Bacteria 1080
31 Ga0068861_100046403 3300005719 Bacteria 3275
32 Ga0068861_100111395 3300005719 Bacteria 2193
33 Ga0068861_100298762 3300005719 Bacteria 1394
34 Ga0068863_100003170 3300005841 Bacteria 16256
35 Ga0068863_100007880 3300005841 Bacteria 10415
36 Ga0068863_100090753 3300005841 Bacteria 2897
37 Ga0068862_100372805 3300005844 Bacteria 1329
38 Ga0070712_100213819 3300006175 Bacteria 1522
39 Ga0075366_10015458 3300006195 Bacteria 4375
40 Ga0075366_10024181 3300006195 Bacteria 3544
41 Ga0075428_100199565 3300006844 Bacteria 2163
42 Ga0075430_100292406 3300006846 Bacteria 1348
43 Ga0075429_100014673 3300006880 Bacteria 6793
44 Ga0097620_100015989 3300006931 Bacteria 7542
45 Ga0097620_100107391 3300006931 Bacteria 2851
46 Ga0097620_100252291 3300006931 Bacteria 1855
47 Ga0097620_100260822 3300006931 Unclassified 1824
48 Ga0105240_10270008 3300009093 Bacteria 1959
49 Ga0111539_10082802 3300009094 Bacteria 3774
50 Ga0105247_10001960 3300009101 Bacteria 14314
51 Ga0105242_10152743 3300009176 Bacteria 2015
52 Ga0105237_10003435 3300009545 Bacteria 18798
53 Ga0105237_10122200 3300009545 Bacteria 2598
54 Ga0105237_10251800 3300009545 Bacteria 1768
55 Ga0105249_10005625 3300009553 Bacteria 10842
56 Ga0105249_10010218 3300009553 Bacteria 8243
57 Ga0105239_10009010 3300010375 Bacteria 11295
58 Ga0105239_10774501 3300010375 Unclassified 1099
59 Ga0157371_10156147 3300013102 Unclassified 1628
60 Ga0157369_10361948 3300013105 Unclassified 1506
61 Ga0157374_10024430 3300013296 Bacteria 5420
62 Ga0157374_10122811 3300013296 Bacteria 2508
63 Ga0157378_10014153 3300013297 Bacteria 6981
64 Ga0157372_10253632 3300013307 Bacteria 2042
65 Ga0163163_10350072 3300014325 Bacteria 1533
66 Ga0182008_10003011 3300014497 Bacteria 10354
67 Ga0157377_10003612 3300014745 Bacteria 7007
68 Ga0182006_1051602 3300015261 Unclassified 1582
69 Ga0182006_1053265 3300015261 Unclassified 1552
70 Ga0209646_1001931 3300025246 Bacteria 5017
71 Ga0209676_1001044 3300025292 Bacteria 31924
72 Ga0207697_10088939 3300025315 Bacteria 1308
73 Ga0207697_10108928 3300025315 Unclassified 1185
74 Ga0207710_10000402 3300025900 Bacteria 28743
75 Ga0207680_10194826 3300025903 Bacteria 1378
76 Ga0207645_10024656 3300025907 Bacteria 3896
77 Ga0207645_10105785 3300025907 Bacteria 1818
78 Ga0207695_10305599 3300025913 Bacteria 1481
79 Ga0207671_10084154 3300025914 Bacteria 2389
80 Ga0207662_10024919 3300025918 Bacteria 3444
81 Ga0207706_10469603 3300025933 Bacteria 1087
82 Ga0207686_10186706 3300025934 Bacteria 1474
83 Ga0207669_10117684 3300025937 Unclassified 1796
84 Ga0207669_10371928 3300025937 Bacteria 1111
85 Ga0207691_10022955 3300025940 Bacteria 5877
86 Ga0207691_10035838 3300025940 Bacteria 4601
87 Ga0207689_10003402 3300025942 Bacteria 14529
88 Ga0207689_10376786 3300025942 Unclassified 1181
89 Ga0207661_10112816 3300025944 Bacteria 2302
90 Ga0207667_10064500 3300025949 Bacteria 3824
91 Ga0207651_10152939 3300025960 Bacteria 1799
92 Ga0207668_10068396 3300025972 Bacteria 2525
93 Ga0207677_10099636 3300026023 Bacteria 2134
94 Ga0207703_10228734 3300026035 Bacteria 1666
95 Ga0207639_10280667 3300026041 Bacteria 1465
96 Ga0207702_10000446 3300026078 Bacteria 46754
97 Ga0207702_10066496 3300026078 Unclassified 3090
98 Ga0207702_10081458 3300026078 Unclassified 2811
99 Ga0207641_10025564 3300026088 Bacteria 4869
100 Ga0207648_10250150 3300026089 Bacteria 1580
101 Ga0207648_10330064 3300026089 Bacteria 1372
102 Ga0207676_10084555 3300026095 Bacteria 2587
103 Ga0207674_10532033 3300026116 Unclassified 1135
104 Ga0207675_100071599 3300026118 Bacteria 3242
105 Ga0207675_100240308 3300026118 Bacteria 1750
106 Ga0207675_100324338 3300026118 Bacteria 1504
107 Ga0207683_10014247 3300026121 Bacteria 6773
108 Ga0207698_10398601 3300026142 Bacteria 1314
109 Ga0207698_10498036 3300026142 Bacteria 1185
110 Ga0268264_10129600 3300028381 Bacteria 2234
111 Ga0268264_10142079 3300028381 Bacteria 2142
112 Ga0268264_10265736 3300028381 Bacteria 1601
113 Ga0265327_10000034 3300031251 Bacteria 316018
114 Ga0265316_10003076 3300031344 Bacteria 17019
115 Ga0265316_10401809 3300031344 Bacteria 987
116 Ga0307513_10057711 3300031456 Bacteria 4133
117 Ga0307513_10162437 3300031456 Bacteria 2124
118 Ga0307509_10044790 3300031507 Bacteria 4777
119 Ga0307406_10106235 3300031901 Bacteria 1923
120 Ga0451853_2264922 3300041512 Bacteria 1244
121 Ga0439449_0077473 3300042007 Unclassified 1226
122 Ga0439457_002312 3300042014 Bacteria 5477
123 Ga0451577_0071448 3300042876 Bacteria 3095
124 Ga0466969_0000952 3300044656 Bacteria 15600
125 Ga0466972_0000013 3300044658 Bacteria 229345
126 Ga0466972_0008769 3300044658 Bacteria 5072
127 Ga0466966_0000365 3300044684 Bacteria 29447
128 Ga0466961_0252826 3300044693 Bacteria 1082
129 Ga0453684_0001177 3300044712 Bacteria 81167
130 Ga0466957_0000191 3300044842 Bacteria 28130
131 Ga0466957_0009909 3300044842 Bacteria 5449
132 Ga0466959_0000056 3300045049 Bacteria 78465
133 Ga0451576_0617833 3300045051 Unclassified 1139
134 Ga0495664_0131292 3300046477 Bacteria 1517
135 Ga0495672_0010073 3300047320 Bacteria 6766
136 Ga0495686_0010384 3300047472 Bacteria 6628
137 Ga0501032_0085010 3300049569 Bacteria 2103
138 Ga0501033_0079812 3300049570 Bacteria 2401
139 Ga0501034_0001945 3300049571 Bacteria 26170
140 Ga0501037_0005753 3300049573 Bacteria 9054
141 Ga0501037_0043279 3300049573 Bacteria 3310
142 Ga0501038_0028993 3300049574 Bacteria 4910
143 Ga0501043_0017443 3300049579 Bacteria 5627
144 Ga0501047_0018679 3300049581 Bacteria 6648
145 Ga0501047_0039791 3300049581 Bacteria 4547
146 Ga0501047_0178594 3300049581 Bacteria 1990
147 Ga0501047_0364968 3300049581 Bacteria 1279
148 Ga0501047_0398061 3300049581 Unclassified 1210
149 Ga0501219_001104 3300049703 Bacteria 3051
150 Ga0501225_0003526 3300049705 Bacteria 4718
151 Ga0501035_0025785 3300049822 Bacteria 5388
152 Ga0501044_0002880 3300049823 Bacteria 19578
153 Ga0501044_0021107 3300049823 Bacteria 6953
154 Ga0501284_00021 3300050005 Bacteria 89729
155 nmdc:mga0k408_5067_c1 3300050493 Bacteria 6981
156 nmdc:mga0k408_74392_c1 3300050493 Bacteria 1985
157 Ga0500578_0000150 3300053086 Bacteria 83541
158 Ga0500578_0148337 3300053086 Bacteria 1462
159 Ga0500583_0000188 3300053092 Bacteria 24682
160 Ga0500583_0000954 3300053092 Bacteria 8231
161 Ga0500658_0118987 3300053134 Bacteria 1170
162 Ga0500589_048891 3300053147 Bacteria 1966
163 Ga0500611_000006 3300053727 Bacteria 226069

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003322 rootL2_10357314 rootL2_103573141 225
2 3300042014 Ga0439457_002312 Ga0439457_002312_2275_3216 226
3 3300006195 Ga0075366_10015458 Ga0075366_100154585 227
4 3300049705 Ga0501225_0003526 Ga0501225_0003526_57_995 227
5 3300003323 rootH1_10011906 rootH1_100119065 230
6 3300005471 Ga0070698_100179171 Ga0070698_1001791712 231
7 3300006195 Ga0075366_10024181 Ga0075366_100241813 231
8 3300042007 Ga0439449_0077473 Ga0439449_0077473_276_1214 231
9 3300005356 Ga0070674_100009916 Ga0070674_1000099162 243
10 3300009094 Ga0111539_10082802 Ga0111539_100828021 243
11 3300025937 Ga0207669_10117684 Ga0207669_101176843 243
12 3300049569 Ga0501032_0085010 Ga0501032_0085010_17_904 243
13 3300049571 Ga0501034_0001945 Ga0501034_0001945_6095_6982 243
14 3300049574 Ga0501038_0028993 Ga0501038_0028993_324_1211 243
15 3300049822 Ga0501035_0025785 Ga0501035_0025785_3143_4030 243
16 3300053134 Ga0500658_0118987 Ga0500658_0118987_176_1114 249
17 3300005338 Ga0068868_100091456 Ga0068868_1000914562 250
18 3300025940 Ga0207691_10035838 Ga0207691_100358385 250
19 3300026023 Ga0207677_10099636 Ga0207677_100996362 250
20 3300026142 Ga0207698_10498036 Ga0207698_104980362 250
21 3300005328 Ga0070676_10129985 Ga0070676_101299852 252
22 3300025907 Ga0207645_10105785 Ga0207645_101057852 252
23 3300026089 Ga0207648_10250150 Ga0207648_102501502 252
24 3300005844 Ga0068862_100372805 Ga0068862_1003728052 253
25 3300050493 nmdc:mga0k408_5067_c1 nmdc:mga0k408_5067_c1_4046_4987 253
26 3300005617 Ga0068859_100107412 Ga0068859_1001074122 255
27 3300006931 Ga0097620_100107391 Ga0097620_1001073912 255
28 3300009553 Ga0105249_10010218 Ga0105249_100102182 255
29 3300013102 Ga0157371_10156147 Ga0157371_101561472 255
30 3300026095 Ga0207676_10084555 Ga0207676_100845551 255
31 3300028381 Ga0268264_10265736 Ga0268264_102657362 255
32 3300009101 Ga0105247_10001960 Ga0105247_100019604 256
33 3300025900 Ga0207710_10000402 Ga0207710_1000040221 256
34 3300049581 Ga0501047_0364968 Ga0501047_0364968_105_1040 256
35 3300005331 Ga0070670_100139406 Ga0070670_1001394062 258
36 3300005535 Ga0070684_100047650 Ga0070684_1000476503 258
37 3300005577 Ga0068857_100526179 Ga0068857_1005261791 258
38 3300014325 Ga0163163_10350072 Ga0163163_103500722 258
39 3300025944 Ga0207661_10112816 Ga0207661_101128162 258
40 3300026116 Ga0207674_10532033 Ga0207674_105320332 258
41 3300049581 Ga0501047_0398061 Ga0501047_0398061_248_1186 258
42 3300005614 Ga0068856_100058841 Ga0068856_1000588413 259
43 3300009093 Ga0105240_10270008 Ga0105240_102700082 259
44 3300009545 Ga0105237_10122200 Ga0105237_101222002 259
45 3300010375 Ga0105239_10009010 Ga0105239_1000901010 259
46 3300013105 Ga0157369_10361948 Ga0157369_103619482 259
47 3300025913 Ga0207695_10305599 Ga0207695_103055992 259
48 3300025914 Ga0207671_10084154 Ga0207671_100841541 259
49 3300025949 Ga0207667_10064500 Ga0207667_100645002 259
50 3300026078 Ga0207702_10081458 Ga0207702_100814582 259
51 3300044842 Ga0466957_0000191 Ga0466957_0000191_20599_21546 259
52 3300047320 Ga0495672_0010073 Ga0495672_0010073_2600_3541 259
53 3300031344 Ga0265316_10401809 Ga0265316_104018091 260
54 3300053092 Ga0500583_0000954 Ga0500583_0000954_6495_7448 260
55 3300053147 Ga0500589_048891 Ga0500589_048891_269_1222 260
56 3300005719 Ga0068861_100111395 Ga0068861_1001113952 261
57 3300005841 Ga0068863_100090753 Ga0068863_1000907533 261
58 3300026118 Ga0207675_100240308 Ga0207675_1002403082 261
59 3300044842 Ga0466957_0009909 Ga0466957_0009909_3041_3991 261
60 3300013307 Ga0157372_10253632 Ga0157372_102536322 262
61 3300031251 Ga0265327_10000034 Ga0265327_10000034172 262
62 3300045051 Ga0451576_0617833 Ga0451576_0617833_43_993 262
63 3300031507 Ga0307509_10044790 Ga0307509_100447905 263
64 3300042876 Ga0451577_0071448 Ga0451577_0071448_1772_2665 263
65 3300044712 Ga0453684_0001177 Ga0453684_0001177_7734_8627 263
66 3300046477 Ga0495664_0131292 Ga0495664_0131292_543_1481 263
67 3300049570 Ga0501033_0079812 Ga0501033_0079812_212_1159 263
68 3300049573 Ga0501037_0005753 Ga0501037_0005753_1987_2973 263
69 3300049579 Ga0501043_0017443 Ga0501043_0017443_1576_2523 263
70 3300049581 Ga0501047_0018679 Ga0501047_0018679_4117_5064 263
71 3300049823 Ga0501044_0021107 Ga0501044_0021107_5792_6739 263
72 3300005719 Ga0068861_100298762 Ga0068861_1002987622 264
73 3300026041 Ga0207639_10280667 Ga0207639_102806672 264
74 3300026118 Ga0207675_100324338 Ga0207675_1003243382 264
75 3300005617 Ga0068859_100252276 Ga0068859_1002522762 265
76 3300005719 Ga0068861_100046403 Ga0068861_1000464033 265
77 3300006931 Ga0097620_100252291 Ga0097620_1002522912 265
78 3300026118 Ga0207675_100071599 Ga0207675_1000715992 265
79 3300049703 Ga0501219_001104 Ga0501219_001104_423_1361 265
80 3300050005 Ga0501284_00021 Ga0501284_00021_24964_25902 265
81 3300009553 Ga0105249_10005625 Ga0105249_1000562513 266
82 3300006844 Ga0075428_100199565 Ga0075428_1001995651 268
83 3300006846 Ga0075430_100292406 Ga0075430_1002924062 268
84 3300006880 Ga0075429_100014673 Ga0075429_1000146736 268
85 3300003781 Ga0055536_1003713 Ga0055536_10037133 269
86 3300005262 Ga0065165_1000501 Ga0065165_10005016 269
87 3300025292 Ga0209676_1001044 Ga0209676_100104417 269
88 3300031456 Ga0307513_10057711 Ga0307513_100577114 269
89 3300041512 Ga0451853_2264922 Ga0451853_2264922_68_1012 269
90 3300006175 Ga0070712_100213819 Ga0070712_1002138192 270
91 3300031344 Ga0265316_10003076 Ga0265316_1000307612 270
92 3300053092 Ga0500583_0000188 Ga0500583_0000188_13999_14934 270
93 3300005328 Ga0070676_10023370 Ga0070676_100233702 271
94 3300005340 Ga0070689_100038045 Ga0070689_1000380453 271
95 3300005343 Ga0070687_100054243 Ga0070687_1000542431 271
96 3300005364 Ga0070673_100217446 Ga0070673_1002174462 271
97 3300005459 Ga0068867_100297137 Ga0068867_1002971371 271
98 3300005543 Ga0070672_100064800 Ga0070672_1000648002 271
99 3300005564 Ga0070664_100052458 Ga0070664_1000524584 271
100 3300005615 Ga0070702_100020388 Ga0070702_1000203884 271
101 3300005618 Ga0068864_100587381 Ga0068864_1005873812 271
102 3300009176 Ga0105242_10152743 Ga0105242_101527432 271
103 3300009545 Ga0105237_10251800 Ga0105237_102518002 271
104 3300010375 Ga0105239_10774501 Ga0105239_107745012 271
105 3300013296 Ga0157374_10122811 Ga0157374_101228112 271
106 3300013297 Ga0157378_10014153 Ga0157378_100141536 271
107 3300014745 Ga0157377_10003612 Ga0157377_100036123 271
108 3300025315 Ga0207697_10108928 Ga0207697_101089282 271
109 3300025903 Ga0207680_10194826 Ga0207680_101948262 271
110 3300025907 Ga0207645_10024656 Ga0207645_100246562 271
111 3300025918 Ga0207662_10024919 Ga0207662_100249194 271
112 3300025933 Ga0207706_10469603 Ga0207706_104696031 271
113 3300025934 Ga0207686_10186706 Ga0207686_101867062 271
114 3300025942 Ga0207689_10376786 Ga0207689_103767862 271
115 3300025972 Ga0207668_10068396 Ga0207668_100683962 271
116 3300026035 Ga0207703_10228734 Ga0207703_102287342 271
117 3300026089 Ga0207648_10330064 Ga0207648_103300642 271
118 3300026142 Ga0207698_10398601 Ga0207698_103986012 271
119 3300044658 Ga0466972_0000013 Ga0466972_0000013_43094_44044 271
120 3300053086 Ga0500578_0000150 Ga0500578_0000150_24748_25698 271
121 3300053086 Ga0500578_0148337 Ga0500578_0148337_397_1347 271
122 3300025942 Ga0207689_10003402 Ga0207689_1000340213 272
123 3300028381 Ga0268264_10142079 Ga0268264_101420792 272
124 3300049581 Ga0501047_0178594 Ga0501047_0178594_698_1636 272
125 iso_pu_bacteria 2738543023 2739300295 272
126 3300005841 Ga0068863_100003170 Ga0068863_10000317014 273
127 3300025246 Ga0209646_1001931 Ga0209646_10019314 273
128 3300025937 Ga0207669_10371928 Ga0207669_103719282 273
129 3300031456 Ga0307513_10162437 Ga0307513_101624372 273
130 3300044656 Ga0466969_0000952 Ga0466969_0000952_3925_4866 273
131 3300044658 Ga0466972_0008769 Ga0466972_0008769_2137_3087 273
132 3300044684 Ga0466966_0000365 Ga0466966_0000365_910_1851 273
133 3300044693 Ga0466961_0252826 Ga0466961_0252826_81_1022 273
134 3300045049 Ga0466959_0000056 Ga0466959_0000056_77102_78043 273
135 3300049581 Ga0501047_0039791 Ga0501047_0039791_3048_3989 273
136 3300049823 Ga0501044_0002880 Ga0501044_0002880_14792_15733 273
137 iso_pu_bacteria 2738541278 2738726397 273
138 3300005617 Ga0068859_100015989 Ga0068859_1000159892 274
139 3300005617 Ga0068859_100260828 Ga0068859_1002608282 274
140 3300006931 Ga0097620_100015989 Ga0097620_10001598910 274
141 3300006931 Ga0097620_100260822 Ga0097620_1002608222 274
142 3300013296 Ga0157374_10024430 Ga0157374_100244303 274
143 3300028381 Ga0268264_10129600 Ga0268264_101296002 274
144 iso_pu_bacteria 2738541283 2738758655 274
145 3300005333 Ga0070677_10077700 Ga0070677_100777001 275
146 3300005456 Ga0070678_100016352 Ga0070678_1000163523 275
147 3300005614 Ga0068856_100000351 Ga0068856_10000035110 275
148 3300005614 Ga0068856_100005837 Ga0068856_10000583714 275
149 3300005841 Ga0068863_100007880 Ga0068863_1000078804 275
150 3300025315 Ga0207697_10088939 Ga0207697_100889392 275
151 3300026078 Ga0207702_10000446 Ga0207702_1000044628 275
152 3300026078 Ga0207702_10066496 Ga0207702_100664963 275
153 3300026088 Ga0207641_10025564 Ga0207641_100255644 275
154 3300026121 Ga0207683_10014247 Ga0207683_100142473 275
155 3300031901 Ga0307406_10106235 Ga0307406_101062352 275
156 3300053727 Ga0500611_000006 Ga0500611_000006_110065_110994 275
157 3300047472 Ga0495686_0010384 Ga0495686_0010384_2492_3433 277
158 3300049573 Ga0501037_0043279 Ga0501037_0043279_1470_2420 277
159 3300003320 rootH2_10007492 rootH2_100074927 278
160 3300009545 Ga0105237_10003435 Ga0105237_1000343514 278
161 3300014497 Ga0182008_10003011 Ga0182008_100030118 278
162 3300015261 Ga0182006_1051602 Ga0182006_10516022 278
163 3300015261 Ga0182006_1053265 Ga0182006_10532652 278
164 3300025940 Ga0207691_10022955 Ga0207691_100229556 278
165 3300025960 Ga0207651_10152939 Ga0207651_101529391 278
166 3300050493 nmdc:mga0k408_74392_c1 nmdc:mga0k408_74392_c1_660_1601 278

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13533

Biotin_lipoyl_2

Biotin-lipoyl like

32

82

0.96

PF16576

HlyD_D23

Barrel-sandwich domain of CusB or HlyD membrane-fusion

26

306

0.86

PF13437

HlyD_3

HlyD family secretion protein

191

304

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wta-assembly1.cif.gz_D cryo-em structure of human pyruvate carboxylase in apo state 0.8627 37 187
5gua-assembly1.cif.gz_A structure of biotin carboxyl carrier protein from pyrococcus horikoshi ot3 (delta n79) a138y mutant 0.8588 34 188
4rcn-assembly1.cif.gz_B structure and function of a single-chain, multi-domain long-chain acyl-coa carboxylase 0.8578 35 189
5ks8-assembly1.cif.gz_F crystal structure of two-subunit pyruvate carboxylase from methylobacillus flagellatus 0.8545 37 187
5vyz-assembly1.cif.gz_A crystal structure of lactococcus lactis pyruvate carboxylase in complex with cyclic-di-amp 0.8526 37 187
ID Description Score Start End Superfamily
4l8jA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9568 34 189 2.40.50.100
4tkoB02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9226 34 189 2.40.50.100
4tkoB02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9095 34 189 2.40.50.100
4l8jA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8947 34 189 2.40.50.100
3fppB02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8937 34 190 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A3M1Z334-F1-model_v4 HlyD family secretion protein 0.9445 190 278
AF-A0A0J9E544-F1-model_v4 Putative Co/Zn/Cd efflux system membrane fusion protein 0.9 136 276 GO:0015562
GO:1990281
AF-F4KZY9-F1-model_v4 Efflux transporter, RND family, MFP subunit 0.8747 27 276 GO:0015562
GO:1990281
AF-A0A432G4S3-F1-model_v4 Efflux RND transporter periplasmic adaptor subunit 0.8706 27 276 GO:0015562
GO:1990281
AF-A0A5R9GFE1-F1-model_v4 Efflux RND transporter periplasmic adaptor subunit 0.8636 27 276 GO:0015562
GO:1990281

Feature Viewer

pLDDT pTM Quality
77.85 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map