F247113

General Info

Members Datasets Scaffolds Average Seq Length
165 119 164 261

Family's Representative Sequence

Representative Sequence 3300049578|Ga0501042_0146876|Ga0501042_0146876_114_977
Length 287
Sequence VSDLRKSRDNGNSPGGGSSRGHLLRRHAPITDKAWSEIDDEARDRLQPALAARKLVDFEGPLGWEHSATNLGRVQAVEGEHVTGVQALQRRVLPLVELRAPFTVSRDELRDIDRGAVDADFESLDAAAQRLAVAENQAVFHGLAASGVEGVCQATTHPTIELNGDGYDRYPTHVARAVEMLLSAGIEGPYGLAVSPEGYTGVIETTERGGYPLLDHLKKIVGGPLVWAPGVTGAVVVSLRGGDFLFESGQDISVGYDSHDADVVNLYLEESFSFRVATPEAAVALVP

Samples

Sample ID Description Type Environment
1 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
38 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
39 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
58 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
59 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
60 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
61 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
62 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
63 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
64 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
65 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
66 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
67 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
68 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
69 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
70 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
71 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
72 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
73 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
74 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
75 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
76 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
77 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
78 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
79 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
84 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
85 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
86 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
87 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
88 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
89 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
90 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
91 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
92 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
93 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
94 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
95 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
96 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
97 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
98 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
99 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
100 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
101 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
102 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
103 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
104 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
105 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
106 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
107 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
108 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
115 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
116 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
117 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
118 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
119 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0
Isolates 0.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.82
Nodule 0
Rhizoplane 18.18
Rhizosphere 75.76
Stem 0
Stem Tuber 0
Unclassified 4.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100230026 3300005329 Bacteria 1763
2 Ga0070683_100397729 3300005329 Bacteria 1314
3 Ga0070666_10204645 3300005335 Bacteria 1389
4 Ga0070687_100048281 3300005343 Bacteria 2188
5 Ga0070668_100205612 3300005347 Bacteria 1618
6 Ga0070671_100399328 3300005355 Bacteria 1176
7 Ga0070674_100437972 3300005356 Bacteria 1076
8 Ga0070714_100058447 3300005435 Bacteria 3303
9 Ga0070711_100015881 3300005439 Bacteria 4770
10 Ga0070711_100238510 3300005439 Bacteria 1421
11 Ga0070705_100058122 3300005440 Bacteria 2285
12 Ga0070663_100396530 3300005455 Bacteria 1127
13 Ga0070678_100018115 3300005456 Bacteria 4557
14 Ga0070681_10396648 3300005458 Bacteria 1291
15 Ga0068867_100112482 3300005459 Bacteria 2094
16 Ga0068867_100385045 3300005459 Bacteria 1179
17 Ga0070679_100090331 3300005530 Unclassified 3051
18 Ga0070696_100126202 3300005546 Bacteria 1857
19 Ga0070693_100091175 3300005547 Unclassified 1837
20 Ga0068854_100241059 3300005578 Bacteria 1440
21 Ga0068859_100167967 3300005617 Bacteria 2274
22 Ga0081538_10021916 3300005981 Bacteria 4646
23 Ga0081538_10025785 3300005981 Bacteria 4134
24 Ga0081540_1027599 3300005983 Bacteria 3211
25 Ga0081539_10006065 3300005985 Bacteria 11821
26 Ga0081539_10017242 3300005985 Bacteria 5084
27 Ga0070715_10199124 3300006163 Bacteria 1016
28 Ga0070712_100005578 3300006175 Bacteria 7784
29 Ga0070712_100451223 3300006175 Bacteria 1071
30 Ga0068871_100037316 3300006358 Bacteria 3874
31 Ga0068865_100074873 3300006881 Bacteria 2412
32 Ga0097620_100167967 3300006931 Bacteria 2274
33 Ga0105245_10475442 3300009098 Bacteria 1262
34 Ga0105247_10058433 3300009101 Bacteria 2386
35 Ga0105243_10010426 3300009148 Bacteria 7057
36 Ga0105243_10301774 3300009148 Bacteria 1452
37 Ga0105241_10048600 3300009174 Bacteria 3229
38 Ga0105242_10013347 3300009176 Bacteria 6346
39 Ga0105248_10096431 3300009177 Bacteria 3331
40 Ga0105239_10450775 3300010375 Bacteria 1460
41 Ga0157372_10114001 3300013307 Bacteria 3098
42 Ga0157375_11000675 3300013308 Bacteria 976
43 Ga0157379_10003193 3300014968 Bacteria 13886
44 Ga0157379_10005072 3300014968 Bacteria 11290
45 Ga0157376_10038619 3300014969 Bacteria 3886
46 Ga0207692_10054197 3300025898 Bacteria 2046
47 Ga0207710_10029198 3300025900 Bacteria 2398
48 Ga0207685_10164314 3300025905 Bacteria 1016
49 Ga0207654_10111973 3300025911 Bacteria 1700
50 Ga0207693_10002081 3300025915 Bacteria 17492
51 Ga0207693_10373788 3300025915 Bacteria 1115
52 Ga0207663_10174626 3300025916 Bacteria 1529
53 Ga0207660_10041529 3300025917 Bacteria 3223
54 Ga0207664_10048986 3300025929 Bacteria 3325
55 Ga0207644_10480768 3300025931 Bacteria 1023
56 Ga0207709_10069674 3300025935 Bacteria 2227
57 Ga0207704_10024125 3300025938 Bacteria 3292
58 Ga0207711_10049696 3300025941 Bacteria 3590
59 Ga0207677_10475420 3300026023 Bacteria 1076
60 Ga0207702_10333119 3300026078 Bacteria 1448
61 Ga0207641_10813293 3300026088 Bacteria 925
62 Ga0207648_10017014 3300026089 Bacteria 6626
63 Ga0207648_10057764 3300026089 Bacteria 3385
64 Ga0207675_100665089 3300026118 Unclassified 1048
65 Ga0207683_10000640 3300026121 Bacteria 32015
66 Ga0265338_10023929 3300028800 Bacteria 6259
67 Ga0265327_10003187 3300031251 Bacteria 16021
68 Ga0307408_100120492 3300031548 Bacteria 2032
69 Ga0307413_10209965 3300031824 Bacteria 1413
70 Ga0307406_10364143 3300031901 Bacteria 1134
71 Ga0307407_10013206 3300031903 Bacteria 3999
72 Ga0307411_10023115 3300032005 Bacteria 3675
73 Ga0373943_0052766 3300035170 Bacteria 2006
74 Ga0373937_0143415 3300036401 Bacteria 2235
75 Ga0395899_0025670 3300037312 Bacteria 4447
76 Ga0395899_0145649 3300037312 Bacteria 1682
77 Ga0395899_0230603 3300037312 Bacteria 1279
78 Ga0395900_0174980 3300037418 Bacteria 2183
79 Ga0395898_0198844 3300037466 Bacteria 1914
80 Ga0395898_0218139 3300037466 Bacteria 1820
81 Ga0395898_0283027 3300037466 Bacteria 1582
82 Ga0395898_0368642 3300037466 Bacteria 1369
83 Ga0395905_0017107 3300037471 Bacteria 6886
84 Ga0395905_0121329 3300037471 Bacteria 2457
85 Ga0395905_0224541 3300037471 Bacteria 1757
86 Ga0395901_0026964 3300038443 Bacteria 5899
87 Ga0395901_0159917 3300038443 Bacteria 2366
88 Ga0395901_0166406 3300038443 Bacteria 2315
89 Ga0395901_0372968 3300038443 Bacteria 1470
90 Ga0436365_0157247 3300039437 Bacteria 20207
91 Ga0466965_0158466 3300044683 Bacteria 1186
92 Ga0466961_0253019 3300044693 Bacteria 1081
93 Ga0466963_0066498 3300044694 Bacteria 2418
94 Ga0466963_0096351 3300044694 Bacteria 2021
95 Ga0466964_0026243 3300044706 Bacteria 2280
96 Ga0466971_0048721 3300044719 Bacteria 1905
97 Ga0466970_0184025 3300044765 Bacteria 1160
98 Ga0466970_0226339 3300044765 Bacteria 1044
99 Ga0466957_0180671 3300044842 Bacteria 1378
100 Ga0466960_0000037 3300044901 Bacteria 43394
101 Ga0466959_0064534 3300045049 Bacteria 2659
102 Ga0466959_0200148 3300045049 Bacteria 1391
103 Ga0466958_0182136 3300045836 Bacteria 1333
104 Ga0466967_0000002 3300045976 Bacteria 219994
105 Ga0466967_0002576 3300045976 Bacteria 11382
106 Ga0466967_0081067 3300045976 Bacteria 2930
107 Ga0466967_0222708 3300045976 Bacteria 1793
108 Ga0466967_0425847 3300045976 Bacteria 1294
109 Ga0466967_0453537 3300045976 Bacteria 1253
110 Ga0466967_0823854 3300045976 Bacteria 922
111 Ga0495603_0105948 3300046455 Bacteria 1641
112 Ga0495650_0000035 3300046471 Bacteria 403799
113 Ga0495588_0131926 3300046674 Bacteria 1318
114 Ga0495658_0116448 3300046683 Bacteria 1612
115 Ga0495624_0205978 3300046690 Unclassified 1194
116 Ga0495672_0021438 3300047320 Bacteria 4215
117 Ga0496100_0012431 3300048903 Bacteria 4880
118 Ga0496100_0123020 3300048903 Bacteria 1818
119 Ga0496100_0244227 3300048903 Bacteria 1326
120 Ga0496101_0032490 3300048904 Bacteria 3674
121 Ga0496101_0090478 3300048904 Bacteria 2276
122 Ga0496101_0218342 3300048904 Bacteria 1479
123 Ga0496102_0048030 3300048905 Bacteria 3880
124 Ga0496102_0166046 3300048905 Bacteria 2077
125 Ga0496103_0010835 3300048906 Bacteria 5396
126 Ga0496103_0182289 3300048906 Bacteria 1350
127 Ga0496104_0007627 3300048907 Bacteria 9581
128 Ga0496104_0049601 3300048907 Bacteria 3958
129 Ga0496105_0008271 3300048908 Bacteria 8090
130 Ga0496105_0071802 3300048908 Bacteria 2861
131 Ga0496106_0053307 3300048909 Bacteria 3054
132 Ga0496106_0172652 3300048909 Bacteria 1714
133 Ga0496107_0001480 3300048910 Bacteria 14533
134 Ga0496107_0015687 3300048910 Bacteria 5311
135 Ga0496108_0019593 3300048911 Bacteria 5557
136 Ga0496109_0000539 3300048912 Bacteria 32004
137 Ga0496109_0010909 3300048912 Bacteria 7783
138 Ga0496109_0099665 3300048912 Bacteria 2695
139 Ga0496110_0085583 3300048913 Bacteria 2813
140 Ga0496111_0198772 3300048914 Bacteria 1490
141 Ga0496112_0007231 3300048915 Bacteria 9840
142 Ga0496112_0032201 3300048915 Bacteria 5090
143 Ga0496112_0199460 3300048915 Bacteria 1961
144 Ga0496113_0089946 3300048916 Bacteria 2364
145 Ga0496114_0011880 3300048917 Bacteria 6969
146 Ga0496114_0332544 3300048917 Bacteria 1343
147 Ga0496117_0037620 3300048920 Bacteria 3603
148 Ga0496119_0131220 3300048922 Bacteria 1365
149 Ga0496121_0064634 3300048924 Bacteria 2982
150 Ga0496124_0289047 3300048927 Bacteria 1191
151 Ga0496126_0078878 3300048929 Bacteria 2917
152 Ga0501034_0005460 3300049571 Bacteria 13884
153 Ga0501034_0607424 3300049571 Bacteria 999
154 Ga0501042_0146876 3300049578 Bacteria 1700
155 Ga0501043_0023737 3300049579 Bacteria 4810
156 Ga0501046_0540502 3300049580 Bacteria 831
157 Ga0501047_0263569 3300049581 Bacteria 1570
158 Ga0501080_0010205 3300049742 Bacteria 8588
159 Ga0501044_0200833 3300049823 Bacteria 1952
160 Ga0495655_0030289 3300053083 Bacteria 1308
161 Ga0500556_0000750 3300053104 Bacteria 19347
162 Ga0500616_0006968 3300053153 Bacteria 7278
163 Ga0500616_0013239 3300053153 Bacteria 4798
164 Ga0501084_0079139 3300054114 Bacteria 2755

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031903 Ga0307407_10013206 Ga0307407_100132062 240
2 3300031548 Ga0307408_100120492 Ga0307408_1001204922 241
3 3300031824 Ga0307413_10209965 Ga0307413_102099652 241
4 3300005547 Ga0070693_100091175 Ga0070693_1000911753 244
5 3300005530 Ga0070679_100090331 Ga0070679_1000903314 245
6 3300013307 Ga0157372_10114001 Ga0157372_101140011 245
7 3300025917 Ga0207660_10041529 Ga0207660_100415292 245
8 3300005335 Ga0070666_10204645 Ga0070666_102046452 246
9 3300005343 Ga0070687_100048281 Ga0070687_1000482813 246
10 3300005355 Ga0070671_100399328 Ga0070671_1003993282 246
11 3300005439 Ga0070711_100238510 Ga0070711_1002385102 246
12 3300005456 Ga0070678_100018115 Ga0070678_1000181154 246
13 3300005459 Ga0068867_100385045 Ga0068867_1003850452 246
14 3300005617 Ga0068859_100167967 Ga0068859_1001679674 246
15 3300006358 Ga0068871_100037316 Ga0068871_1000373164 246
16 3300006881 Ga0068865_100074873 Ga0068865_1000748732 246
17 3300006931 Ga0097620_100167967 Ga0097620_1001679672 246
18 3300009098 Ga0105245_10475442 Ga0105245_104754422 246
19 3300009101 Ga0105247_10058433 Ga0105247_100584332 246
20 3300009148 Ga0105243_10010426 Ga0105243_100104269 246
21 3300009174 Ga0105241_10048600 Ga0105241_100486006 246
22 3300009176 Ga0105242_10013347 Ga0105242_100133474 246
23 3300009177 Ga0105248_10096431 Ga0105248_100964312 246
24 3300014968 Ga0157379_10003193 Ga0157379_100031936 246
25 3300014969 Ga0157376_10038619 Ga0157376_100386192 246
26 3300025900 Ga0207710_10029198 Ga0207710_100291983 246
27 3300025911 Ga0207654_10111973 Ga0207654_101119732 246
28 3300025916 Ga0207663_10174626 Ga0207663_101746262 246
29 3300025931 Ga0207644_10480768 Ga0207644_104807682 246
30 3300025935 Ga0207709_10069674 Ga0207709_100696744 246
31 3300025938 Ga0207704_10024125 Ga0207704_100241255 246
32 3300025941 Ga0207711_10049696 Ga0207711_100496966 246
33 3300026089 Ga0207648_10057764 Ga0207648_100577646 246
34 3300026121 Ga0207683_10000640 Ga0207683_100006408 246
35 3300048903 Ga0496100_0012431 Ga0496100_0012431_1306_2106 246
36 3300048904 Ga0496101_0032490 Ga0496101_0032490_1014_1814 246
37 3300048905 Ga0496102_0048030 Ga0496102_0048030_3003_3803 246
38 3300048906 Ga0496103_0010835 Ga0496103_0010835_4341_5141 246
39 3300048907 Ga0496104_0007627 Ga0496104_0007627_4924_5724 246
40 3300048908 Ga0496105_0008271 Ga0496105_0008271_2681_3481 246
41 3300048909 Ga0496106_0053307 Ga0496106_0053307_2017_2817 246
42 3300048910 Ga0496107_0001480 Ga0496107_0001480_7451_8251 246
43 3300048912 Ga0496109_0099665 Ga0496109_0099665_959_1759 246
44 3300048917 Ga0496114_0011880 Ga0496114_0011880_3012_3812 246
45 3300026118 Ga0207675_100665089 Ga0207675_1006650892 247
46 3300046674 Ga0495588_0131926 Ga0495588_0131926_270_1070 249
47 3300046683 Ga0495658_0116448 Ga0495658_0116448_801_1601 249
48 3300026088 Ga0207641_10813293 Ga0207641_108132932 250
49 3300049581 Ga0501047_0263569 Ga0501047_0263569_23_781 250
50 3300005440 Ga0070705_100058122 Ga0070705_1000581221 252
51 3300005546 Ga0070696_100126202 Ga0070696_1001262021 252
52 3300005578 Ga0068854_100241059 Ga0068854_1002410592 257
53 3300026078 Ga0207702_10333119 Ga0207702_103331192 257
54 3300048903 Ga0496100_0123020 Ga0496100_0123020_490_1305 257
55 3300048904 Ga0496101_0218342 Ga0496101_0218342_422_1237 257
56 3300048906 Ga0496103_0182289 Ga0496103_0182289_130_945 257
57 3300048907 Ga0496104_0049601 Ga0496104_0049601_1981_2796 257
58 3300048908 Ga0496105_0071802 Ga0496105_0071802_455_1270 257
59 3300048909 Ga0496106_0172652 Ga0496106_0172652_678_1493 257
60 3300048911 Ga0496108_0019593 Ga0496108_0019593_1163_1978 257
61 3300048912 Ga0496109_0010909 Ga0496109_0010909_1670_2485 257
62 3300048913 Ga0496110_0085583 Ga0496110_0085583_1640_2455 257
63 3300048914 Ga0496111_0198772 Ga0496111_0198772_464_1279 257
64 3300048915 Ga0496112_0032201 Ga0496112_0032201_4252_5067 257
65 3300037312 Ga0395899_0025670 Ga0395899_0025670_3182_3985 258
66 3300037466 Ga0395898_0368642 Ga0395898_0368642_199_1002 258
67 3300037471 Ga0395905_0017107 Ga0395905_0017107_2323_3126 258
68 3300038443 Ga0395901_0026964 Ga0395901_0026964_1628_2431 258
69 3300048920 Ga0496117_0037620 Ga0496117_0037620_956_1759 262
70 iso_pu_bacteria 2857729791 2857730708 262
71 3300005435 Ga0070714_100058447 Ga0070714_1000584473 266
72 3300005439 Ga0070711_100015881 Ga0070711_1000158818 266
73 3300006175 Ga0070712_100005578 Ga0070712_1000055785 266
74 3300006175 Ga0070712_100451223 Ga0070712_1004512232 266
75 3300009148 Ga0105243_10301774 Ga0105243_103017742 266
76 3300013308 Ga0157375_11000675 Ga0157375_110006752 266
77 3300025898 Ga0207692_10054197 Ga0207692_100541973 266
78 3300025915 Ga0207693_10002081 Ga0207693_100020815 266
79 3300025915 Ga0207693_10373788 Ga0207693_103737882 266
80 3300025929 Ga0207664_10048986 Ga0207664_100489863 266
81 3300026023 Ga0207677_10475420 Ga0207677_104754201 266
82 3300035170 Ga0373943_0052766 Ga0373943_0052766_605_1405 266
83 3300037312 Ga0395899_0145649 Ga0395899_0145649_162_962 266
84 3300037466 Ga0395898_0283027 Ga0395898_0283027_606_1406 266
85 3300037471 Ga0395905_0224541 Ga0395905_0224541_500_1300 266
86 3300039437 Ga0436365_0157247 Ga0436365_0157247_14022_14822 266
87 3300044683 Ga0466965_0158466 Ga0466965_0158466_69_869 266
88 3300044693 Ga0466961_0253019 Ga0466961_0253019_71_871 266
89 3300044842 Ga0466957_0180671 Ga0466957_0180671_519_1325 266
90 3300045976 Ga0466967_0000002 Ga0466967_0000002_136419_137219 266
91 3300046690 Ga0495624_0205978 Ga0495624_0205978_291_1091 266
92 3300047320 Ga0495672_0021438 Ga0495672_0021438_739_1539 266
93 3300048903 Ga0496100_0244227 Ga0496100_0244227_322_1122 266
94 3300048905 Ga0496102_0166046 Ga0496102_0166046_695_1495 266
95 3300048917 Ga0496114_0332544 Ga0496114_0332544_444_1244 266
96 3300048924 Ga0496121_0064634 Ga0496121_0064634_657_1466 266
97 3300005329 Ga0070683_100397729 Ga0070683_1003977291 267
98 3300005347 Ga0070668_100205612 Ga0070668_1002056122 267
99 3300005455 Ga0070663_100396530 Ga0070663_1003965302 267
100 3300005458 Ga0070681_10396648 Ga0070681_103966482 267
101 3300005459 Ga0068867_100112482 Ga0068867_1001124823 267
102 3300005981 Ga0081538_10021916 Ga0081538_100219162 267
103 3300005981 Ga0081538_10025785 Ga0081538_100257852 267
104 3300005985 Ga0081539_10017242 Ga0081539_100172424 267
105 3300006163 Ga0070715_10199124 Ga0070715_101991242 267
106 3300010375 Ga0105239_10450775 Ga0105239_104507752 267
107 3300014968 Ga0157379_10005072 Ga0157379_100050723 267
108 3300025905 Ga0207685_10164314 Ga0207685_101643141 267
109 3300026089 Ga0207648_10017014 Ga0207648_100170142 267
110 3300028800 Ga0265338_10023929 Ga0265338_100239297 267
111 3300031251 Ga0265327_10003187 Ga0265327_1000318711 267
112 3300036401 Ga0373937_0143415 Ga0373937_0143415_211_1014 267
113 3300037312 Ga0395899_0230603 Ga0395899_0230603_398_1207 267
114 3300037418 Ga0395900_0174980 Ga0395900_0174980_1190_1993 267
115 3300037466 Ga0395898_0198844 Ga0395898_0198844_187_990 267
116 3300037466 Ga0395898_0218139 Ga0395898_0218139_245_1054 267
117 3300037471 Ga0395905_0121329 Ga0395905_0121329_222_1025 267
118 3300038443 Ga0395901_0159917 Ga0395901_0159917_259_1062 267
119 3300038443 Ga0395901_0166406 Ga0395901_0166406_947_1750 267
120 3300038443 Ga0395901_0372968 Ga0395901_0372968_421_1230 267
121 3300044694 Ga0466963_0066498 Ga0466963_0066498_887_1693 267
122 3300044694 Ga0466963_0096351 Ga0466963_0096351_878_1684 267
123 3300044706 Ga0466964_0026243 Ga0466964_0026243_1372_2175 267
124 3300044719 Ga0466971_0048721 Ga0466971_0048721_321_1124 267
125 3300044765 Ga0466970_0184025 Ga0466970_0184025_277_1080 267
126 3300044765 Ga0466970_0226339 Ga0466970_0226339_199_1005 267
127 3300044901 Ga0466960_0000037 Ga0466960_0000037_15960_16778 267
128 3300045049 Ga0466959_0064534 Ga0466959_0064534_1600_2406 267
129 3300045049 Ga0466959_0200148 Ga0466959_0200148_520_1323 267
130 3300045836 Ga0466958_0182136 Ga0466958_0182136_66_869 267
131 3300045976 Ga0466967_0002576 Ga0466967_0002576_3423_4229 267
132 3300045976 Ga0466967_0081067 Ga0466967_0081067_1708_2511 267
133 3300045976 Ga0466967_0425847 Ga0466967_0425847_177_980 267
134 3300045976 Ga0466967_0823854 Ga0466967_0823854_41_847 267
135 3300046471 Ga0495650_0000035 Ga0495650_0000035_90700_91509 267
136 3300048904 Ga0496101_0090478 Ga0496101_0090478_344_1153 267
137 3300048910 Ga0496107_0015687 Ga0496107_0015687_1799_2638 267
138 3300048915 Ga0496112_0007231 Ga0496112_0007231_8280_9089 267
139 3300048915 Ga0496112_0199460 Ga0496112_0199460_228_1034 267
140 3300048916 Ga0496113_0089946 Ga0496113_0089946_565_1374 267
141 3300048922 Ga0496119_0131220 Ga0496119_0131220_330_1133 267
142 3300048927 Ga0496124_0289047 Ga0496124_0289047_18_827 267
143 3300048929 Ga0496126_0078878 Ga0496126_0078878_1814_2617 267
144 3300049571 Ga0501034_0005460 Ga0501034_0005460_7573_8382 267
145 3300049571 Ga0501034_0607424 Ga0501034_0607424_181_987 267
146 3300049578 Ga0501042_0146876 Ga0501042_0146876_114_977 267
147 3300049579 Ga0501043_0023737 Ga0501043_0023737_3501_4364 267
148 3300049580 Ga0501046_0540502 Ga0501046_0540502_10_816 267
149 3300049742 Ga0501080_0010205 Ga0501080_0010205_3509_4372 267
150 3300049823 Ga0501044_0200833 Ga0501044_0200833_1055_1864 267
151 3300053153 Ga0500616_0013239 Ga0500616_0013239_1740_2546 267
152 3300054114 Ga0501084_0079139 Ga0501084_0079139_1832_2695 267
153 3300005329 Ga0070683_100230026 Ga0070683_1002300262 268
154 3300005356 Ga0070674_100437972 Ga0070674_1004379721 268
155 3300005983 Ga0081540_1027599 Ga0081540_10275993 268
156 3300005985 Ga0081539_10006065 Ga0081539_100060653 268
157 3300031901 Ga0307406_10364143 Ga0307406_103641432 268
158 3300032005 Ga0307411_10023115 Ga0307411_100231154 268
159 3300045976 Ga0466967_0222708 Ga0466967_0222708_578_1387 268
160 3300045976 Ga0466967_0453537 Ga0466967_0453537_358_1167 268
161 3300046455 Ga0495603_0105948 Ga0495603_0105948_645_1478 268
162 3300048912 Ga0496109_0000539 Ga0496109_0000539_24717_25532 268
163 3300053083 Ga0495655_0030289 Ga0495655_0030289_181_990 268
164 3300053104 Ga0500556_0000750 Ga0500556_0000750_5818_6627 268
165 3300053153 Ga0500616_0006968 Ga0500616_0006968_1442_2251 268

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04454

Linocin_M18

Encapsulating protein for peroxidase

21

273

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6i9g-assembly1.cif.gz_A crystal structure of encapsulin from mycolicibacterium hassiacum 0.8712 1 266
7boj-assembly1.cif.gz_A cryo-em structure of the encapsulin shell from mycobacterium smegmatis 0.8696 1 266
8ika-assembly1.cif.gz_A1 cryo-em structure of the encapsulin shell from mycobacterium tuberculosis 0.8683 1 266
6i9g-assembly1.cif.gz_A crystal structure of encapsulin from mycolicibacterium hassiacum 0.8649 1 266
7boj-assembly1.cif.gz_A cryo-em structure of the encapsulin shell from mycobacterium smegmatis 0.8633 1 266
ID Description Score Start End Superfamily
3dktA02 Alpha Beta;2-Layer Sandwich;hypothetical protein PF0899 fold;hypothetical protein PF0899 domain 0.8085 143 220 3.30.2320.10
3dktD01 Alpha Beta;2-Layer Sandwich;Major capsid protein gp5 fold; 0.7772 1 256 3.30.2400.30
3dktD01 Alpha Beta;2-Layer Sandwich;Major capsid protein gp5 fold; 0.7729 1 256 3.30.2400.30
2e0zC01 Alpha Beta;2-Layer Sandwich;Major capsid protein gp5 fold; 0.7367 16 252 3.30.2400.20
2e0zC01 Alpha Beta;2-Layer Sandwich;Major capsid protein gp5 fold; 0.6936 16 252 3.30.2400.20
ID Description Score Start End GO Terms
AF-A0A6P4G5J1-F1-model_v4 deleted 0.9515 129 265
AF-A0A2K4P227-F1-model_v4 deleted 0.948 96 267
AF-A0A2S8MKP2-F1-model_v4 deleted 0.9385 162 266
AF-A0A6P4G5J1-F1-model_v4 deleted 0.9382 129 265
AF-W5WIE0-F1-model_v4 Bacteriocin 0.9343 154 265 GO:0140737

Feature Viewer

pLDDT pTM Quality
88.1 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map