F246903

General Info

Members Datasets Scaffolds Average Seq Length
165 126 330 213

Family's Representative Sequence

Representative Sequence 3300046500|Ga0495596_0166008|Ga0495596_0166008_56_760
Length 234
Sequence MPNSPRNEARSLFQKEEIMSEFIVYGIPGSPFMRSVTMTLEEKGAPYRIQSMGPGDSKGEAHLARHPFGRVPAVEHGDFKLYETQAILRYIDAVFPGPALQPADPKAAARMNQIIGINDWYLFPQVAAVLVFQRIVGPVLMGLKPDEAAIAAAVPNATLCLGELNRLLGRSPFMAGGDLSLADIILAPQIDYLAGTPEGSALLKDTQLEAWLARMLARPSMQATLPPEPLRRAA

Samples

Sample ID Description Type Environment
1 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
56 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
57 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
82 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
83 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
84 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
85 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
86 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
87 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
88 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
89 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
94 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
95 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
96 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
97 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
98 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
99 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
100 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
101 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
102 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
103 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
104 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
105 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
106 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
107 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
108 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
109 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
110 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
113 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
114 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
118 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
121 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
122 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
123 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
124 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
125 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
126 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.85
Nodule 0
Rhizoplane 4.85
Rhizosphere 87.27
Stem 0
Stem Tuber 0
Unclassified 21.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495596_0166008 3300046500 Unclassified 858
2 JGI25153J46596_10054699 3300003215 Bacteria 1121
3 Ga0058861_10478414 3300004800 Bacteria 811
4 Ga0070670_100086143 3300005331 Bacteria 2699
5 Ga0070680_100092274 3300005336 Bacteria 2507
6 Ga0070682_100018670 3300005337 Bacteria 4058
7 Ga0068868_100232540 3300005338 Bacteria 1547
8 Ga0070691_10010123 3300005341 Bacteria 4299
9 Ga0070675_100137931 3300005354 Bacteria 2083
10 Ga0070671_100035570 3300005355 Bacteria 4126
11 Ga0070673_100705944 3300005364 Bacteria 926
12 Ga0070673_100855210 3300005364 Bacteria 842
13 Ga0070667_100032113 3300005367 Bacteria 4378
14 Ga0070694_100404510 3300005444 Unclassified 1069
15 Ga0070678_100121509 3300005456 Bacteria 2060
16 Ga0070681_10003002 3300005458 Bacteria 15660
17 Ga0068867_100784437 3300005459 Unclassified 848
18 Ga0070679_100059866 3300005530 Bacteria 3795
19 Ga0070679_100082443 3300005530 Bacteria 3206
20 Ga0070679_100193550 3300005530 Bacteria 2001
21 Ga0070684_100210674 3300005535 Bacteria 1771
22 Ga0070684_100324822 3300005535 Unclassified 1414
23 Ga0070686_100372666 3300005544 Unclassified 1078
24 Ga0070693_100120363 3300005547 Unclassified 1627
25 Ga0070665_100244169 3300005548 Bacteria 1796
26 Ga0068855_100834509 3300005563 Bacteria 977
27 Ga0068855_101214543 3300005563 Bacteria 783
28 Ga0070664_100131656 3300005564 Unclassified 2197
29 Ga0070702_100040146 3300005615 Unclassified 2616
30 Ga0068859_100161475 3300005617 Bacteria 2320
31 Ga0068864_100021073 3300005618 Bacteria 5458
32 Ga0068863_100116569 3300005841 Bacteria 2545
33 Ga0068858_100023597 3300005842 Bacteria 5731
34 Ga0081455_10000446 3300005937 Bacteria 54371
35 Ga0081455_10129190 3300005937 Bacteria 1978
36 Ga0070717_10240946 3300006028 Bacteria 1595
37 Ga0075365_10172572 3300006038 Bacteria 1510
38 Ga0075363_100297372 3300006048 Bacteria 936
39 Ga0068871_100226398 3300006358 Bacteria 1622
40 Ga0068871_100277504 3300006358 Unclassified 1465
41 Ga0068871_100641679 3300006358 Unclassified 969
42 Ga0068865_100947036 3300006881 Unclassified 751
43 Ga0097620_100161481 3300006931 Bacteria 2320
44 Ga0105240_10009275 3300009093 Bacteria 13956
45 Ga0105240_10106590 3300009093 Bacteria 3399
46 Ga0105240_10259988 3300009093 Bacteria 2003
47 Ga0105240_10357831 3300009093 Unclassified 1654
48 Ga0111539_10007838 3300009094 Bacteria 13639
49 Ga0105245_10101423 3300009098 Unclassified 2664
50 Ga0105245_10639285 3300009098 Unclassified 1093
51 Ga0105247_10020935 3300009101 Bacteria 3935
52 Ga0105242_10190870 3300009176 Bacteria 1814
53 Ga0105242_10586214 3300009176 Bacteria 1075
54 Ga0105248_10000384 3300009177 Bacteria 50926
55 Ga0105248_10020534 3300009177 Bacteria 7321
56 Ga0105238_10372791 3300009551 Unclassified 1418
57 Ga0099796_10167149 3300010159 Unclassified 875
58 Ga0105246_10162572 3300011119 Unclassified 1702
59 Ga0157369_10036932 3300013105 Bacteria 5351
60 Ga0157369_10097171 3300013105 Bacteria 3142
61 Ga0157369_10349349 3300013105 Bacteria 1536
62 Ga0157374_10035366 3300013296 Bacteria 4570
63 Ga0157374_10201006 3300013296 Bacteria 1951
64 Ga0157374_10439856 3300013296 Unclassified 1304
65 Ga0157378_10464760 3300013297 Unclassified 1258
66 Ga0163162_10034805 3300013306 Bacteria 5014
67 Ga0163162_11100442 3300013306 Bacteria 900
68 Ga0157372_10170127 3300013307 Bacteria 2521
69 Ga0157375_10179219 3300013308 Bacteria 2270
70 Ga0163163_10038909 3300014325 Bacteria 4638
71 Ga0163163_10135615 3300014325 Bacteria 2503
72 Ga0157377_10127769 3300014745 Unclassified 1548
73 Ga0157379_10048125 3300014968 Bacteria 3806
74 Ga0157376_10145251 3300014969 Bacteria 2133
75 Ga0157376_10161842 3300014969 Unclassified 2030
76 Ga0213874_10002917 3300021377 Bacteria 3733
77 Ga0209758_1002267 3300025297 Bacteria 19939
78 Ga0207710_10174262 3300025900 Unclassified 1053
79 Ga0207680_10021029 3300025903 Bacteria 3524
80 Ga0207707_10029435 3300025912 Bacteria 4801
81 Ga0207707_10097602 3300025912 Bacteria 2568
82 Ga0207695_10018407 3300025913 Bacteria 8079
83 Ga0207695_10083303 3300025913 Bacteria 3231
84 Ga0207695_10112492 3300025913 Bacteria 2700
85 Ga0207660_10205582 3300025917 Bacteria 1539
86 Ga0207652_10119208 3300025921 Bacteria 2347
87 Ga0207694_10034760 3300025924 Bacteria 3866
88 Ga0207694_10055200 3300025924 Bacteria 3084
89 Ga0207694_10639115 3300025924 Unclassified 896
90 Ga0207650_10499843 3300025925 Unclassified 1016
91 Ga0207687_10053083 3300025927 Bacteria 2831
92 Ga0207687_10615305 3300025927 Unclassified 916
93 Ga0207664_10324102 3300025929 Bacteria 1360
94 Ga0207686_10061815 3300025934 Bacteria 2376
95 Ga0207686_10548084 3300025934 Bacteria 904
96 Ga0207711_10000691 3300025941 Bacteria 33231
97 Ga0207711_10005881 3300025941 Bacteria 10356
98 Ga0207689_10739584 3300025942 Bacteria 830
99 Ga0207661_10327416 3300025944 Unclassified 1378
100 Ga0207661_11048814 3300025944 Bacteria 751
101 Ga0207679_10122958 3300025945 Unclassified 2069
102 Ga0207667_10041030 3300025949 Bacteria 4924
103 Ga0207651_10733731 3300025960 Bacteria 872
104 Ga0207658_10064207 3300025986 Bacteria 2753
105 Ga0207703_10028234 3300026035 Bacteria 4421
106 Ga0207676_10007805 3300026095 Bacteria 7612
107 Ga0207676_10214366 3300026095 Bacteria 1711
108 Ga0268266_10531978 3300028379 Bacteria 1125
109 Ga0268264_11066533 3300028381 Unclassified 816
110 Ga0265334_10017135 3300028573 Unclassified 2997
111 Ga0265338_10037890 3300028800 Bacteria 4578
112 Ga0307511_10000348 3300030521 Bacteria 49134
113 Ga0265320_10063844 3300031240 Bacteria 1751
114 Ga0265340_10084609 3300031247 Bacteria 1489
115 Ga0265331_10006933 3300031250 Bacteria 6618
116 Ga0265342_10040847 3300031712 Bacteria 2811
117 Ga0373936_0008073 3300035113 Bacteria 3956
118 Ga0373936_0010642 3300035113 Bacteria 3473
119 Ga0373927_0074448 3300035695 Bacteria 2199
120 Ga0373947_0031951 3300035725 Bacteria 3101
121 Ga0373937_0354733 3300036401 Bacteria 1390
122 Ga0373925_0155718 3300037068 Bacteria 1797
123 Ga0395898_0429505 3300037466 Bacteria 1259
124 Ga0395905_0875388 3300037471 Bacteria 801
125 Ga0436364_0860513 3300037853 Unclassified 1480
126 Ga0436360_1038762 3300039438 Bacteria 6986
127 Ga0436361_0036451 3300039447 Bacteria 1319
128 Ga0436361_0391097 3300039447 Bacteria 1747
129 Ga0436363_0144005 3300039450 Bacteria 20089
130 Ga0436363_0383844 3300039450 Bacteria 11284
131 Ga0466966_0074998 3300044684 Unclassified 2114
132 Ga0466966_0173944 3300044684 Unclassified 1308
133 Ga0466970_0354200 3300044765 Unclassified 833
134 Ga0466959_0006300 3300045049 Bacteria 8202
135 Ga0466959_0084395 3300045049 Unclassified 2286
136 Ga0451576_0038634 3300045051 Bacteria 5052
137 Ga0451576_0755660 3300045051 Unclassified 1021
138 Ga0495603_0061074 3300046455 Bacteria 2226
139 Ga0495651_0040194 3300046462 Bacteria 3639
140 Ga0495628_0015184 3300046516 Bacteria 6434
141 Ga0495640_0303495 3300046533 Bacteria 991
142 Ga0495668_0290496 3300046616 Bacteria 896
143 Ga0495613_0445301 3300046689 Bacteria 878
144 Ga0495600_0140757 3300046809 Bacteria 1565
145 Ga0496106_0179996 3300048909 Bacteria 1678
146 Ga0496106_0363413 3300048909 Bacteria 1163
147 Ga0496108_0035019 3300048911 Bacteria 4172
148 Ga0496109_0022824 3300048912 Bacteria 5545
149 Ga0496112_0009312 3300048915 Bacteria 8835
150 Ga0496114_0006585 3300048917 Bacteria 9159
151 Ga0496115_0000239 3300048918 Bacteria 49984
152 Ga0496115_0106643 3300048918 Bacteria 2300
153 Ga0501036_0490711 3300049572 Bacteria 1022
154 Ga0501043_0051542 3300049579 Bacteria 3234
155 Ga0501047_0025244 3300049581 Bacteria 5710
156 Ga0501070_0041727 3300049586 Bacteria 3821
157 Ga0501080_0284018 3300049742 Bacteria 1504
158 Ga0501044_0002202 3300049823 Bacteria 22354
159 nmdc:mga08y16_373080_c1 3300050511 Bacteria 1463
160 Ga0495601_0101525 3300053077 Bacteria 1858
161 Ga0500595_047020 3300053119 Bacteria 1354
162 Ga0500559_0207620 3300053136 Bacteria 924
163 Ga0500636_0005066 3300053177 Bacteria 7480
164 Ga0500637_0012548 3300053178 Bacteria 4418
165 Ga0501082_0339617 3300060353 Unclassified 1309
166 Ga0495596_0166008
167 JGI25153J46596_10054699
168 Ga0058861_10478414
169 Ga0070670_100086143
170 Ga0070680_100092274
171 Ga0070682_100018670
172 Ga0068868_100232540
173 Ga0070691_10010123
174 Ga0070675_100137931
175 Ga0070671_100035570
176 Ga0070673_100705944
177 Ga0070673_100855210
178 Ga0070667_100032113
179 Ga0070694_100404510
180 Ga0070678_100121509
181 Ga0070681_10003002
182 Ga0068867_100784437
183 Ga0070679_100059866
184 Ga0070679_100082443
185 Ga0070679_100193550
186 Ga0070684_100210674
187 Ga0070684_100324822
188 Ga0070686_100372666
189 Ga0070693_100120363
190 Ga0070665_100244169
191 Ga0068855_100834509
192 Ga0068855_101214543
193 Ga0070664_100131656
194 Ga0070702_100040146
195 Ga0068859_100161475
196 Ga0068864_100021073
197 Ga0068863_100116569
198 Ga0068858_100023597
199 Ga0081455_10000446
200 Ga0081455_10129190
201 Ga0070717_10240946
202 Ga0075365_10172572
203 Ga0075363_100297372
204 Ga0068871_100226398
205 Ga0068871_100277504
206 Ga0068871_100641679
207 Ga0068865_100947036
208 Ga0097620_100161481
209 Ga0105240_10009275
210 Ga0105240_10106590
211 Ga0105240_10259988
212 Ga0105240_10357831
213 Ga0111539_10007838
214 Ga0105245_10101423
215 Ga0105245_10639285
216 Ga0105247_10020935
217 Ga0105242_10190870
218 Ga0105242_10586214
219 Ga0105248_10000384
220 Ga0105248_10020534
221 Ga0105238_10372791
222 Ga0099796_10167149
223 Ga0105246_10162572
224 Ga0157369_10036932
225 Ga0157369_10097171
226 Ga0157369_10349349
227 Ga0157374_10035366
228 Ga0157374_10201006
229 Ga0157374_10439856
230 Ga0157378_10464760
231 Ga0163162_10034805
232 Ga0163162_11100442
233 Ga0157372_10170127
234 Ga0157375_10179219
235 Ga0163163_10038909
236 Ga0163163_10135615
237 Ga0157377_10127769
238 Ga0157379_10048125
239 Ga0157376_10145251
240 Ga0157376_10161842
241 Ga0213874_10002917
242 Ga0209758_1002267
243 Ga0207710_10174262
244 Ga0207680_10021029
245 Ga0207707_10029435
246 Ga0207707_10097602
247 Ga0207695_10018407
248 Ga0207695_10083303
249 Ga0207695_10112492
250 Ga0207660_10205582
251 Ga0207652_10119208
252 Ga0207694_10034760
253 Ga0207694_10055200
254 Ga0207694_10639115
255 Ga0207650_10499843
256 Ga0207687_10053083
257 Ga0207687_10615305
258 Ga0207664_10324102
259 Ga0207686_10061815
260 Ga0207686_10548084
261 Ga0207711_10000691
262 Ga0207711_10005881
263 Ga0207689_10739584
264 Ga0207661_10327416
265 Ga0207661_11048814
266 Ga0207679_10122958
267 Ga0207667_10041030
268 Ga0207651_10733731
269 Ga0207658_10064207
270 Ga0207703_10028234
271 Ga0207676_10007805
272 Ga0207676_10214366
273 Ga0268266_10531978
274 Ga0268264_11066533
275 Ga0265334_10017135
276 Ga0265338_10037890
277 Ga0307511_10000348
278 Ga0265320_10063844
279 Ga0265340_10084609
280 Ga0265331_10006933
281 Ga0265342_10040847
282 Ga0373936_0008073
283 Ga0373936_0010642
284 Ga0373927_0074448
285 Ga0373947_0031951
286 Ga0373937_0354733
287 Ga0373925_0155718
288 Ga0395898_0429505
289 Ga0395905_0875388
290 Ga0436364_0860513
291 Ga0436360_1038762
292 Ga0436361_0036451
293 Ga0436361_0391097
294 Ga0436363_0144005
295 Ga0436363_0383844
296 Ga0466966_0074998
297 Ga0466966_0173944
298 Ga0466970_0354200
299 Ga0466959_0006300
300 Ga0466959_0084395
301 Ga0451576_0038634
302 Ga0451576_0755660
303 Ga0495603_0061074
304 Ga0495651_0040194
305 Ga0495628_0015184
306 Ga0495640_0303495
307 Ga0495668_0290496
308 Ga0495613_0445301
309 Ga0495600_0140757
310 Ga0496106_0179996
311 Ga0496106_0363413
312 Ga0496108_0035019
313 Ga0496109_0022824
314 Ga0496112_0009312
315 Ga0496114_0006585
316 Ga0496115_0000239
317 Ga0496115_0106643
318 Ga0501036_0490711
319 Ga0501043_0051542
320 Ga0501047_0025244
321 Ga0501070_0041727
322 Ga0501080_0284018
323 Ga0501044_0002202
324 nmdc:mga08y16_373080_c1
325 Ga0495601_0101525
326 Ga0500595_047020
327 Ga0500559_0207620
328 Ga0500636_0005066
329 Ga0500637_0012548
330 Ga0501082_0339617

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

29

94

0.95

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

20

93

0.94

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

24

99

0.94

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

147

214

0.92

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

144

225

0.9

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

124

219

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5a4u-assembly1.cif.gz_A atgstf2 from arabidopsis thaliana in complex with indole-3-aldehyde 0.9027 2 207
5a5k-assembly4.cif.gz_D atgstf2 from arabidopsis thaliana in complex with camalexin 0.8977 4 207
6tk8-assembly1.cif.gz_AAA-2 gstf1 f122t variant from alopecurus myosuroides 0.8944 4 206
5f05-assembly1.cif.gz_B crystal structure of glutathione transferase f5 from populus trichocarpa 0.8867 4 208
7odm-assembly1.cif.gz_AAA-2 amgstf1 y118s variant 0.8858 2 209
ID Description Score Start End Superfamily
af_B6U5S1_5_83_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.913 3 84 3.40.30.10
af_B6U5S1_5_83_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9022 3 84 3.40.30.10
3cbuB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9003 5 82 3.40.30.10
4ielA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9003 2 77 3.40.30.10
1aw9A02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9 91 207 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A6A7RNW9-F1-model_v4 glutathione transferase (EC 2.5.1.18) 0.9501 1 209 GO:0004364
GO:0005737
GO:0043295
AF-A0A2U2N4Z7-F1-model_v4 glutathione transferase (EC 2.5.1.18) 0.9489 1 209 GO:0004364
GO:0005737
GO:0043295
AF-A0A5J6MKN2-F1-model_v4 glutathione transferase (EC 2.5.1.18) 0.9453 1 208 GO:0004364
GO:0005737
GO:0043295
AF-A0A420WTL2-F1-model_v4 Glutathione S-transferase 0.942 1 210 GO:0016740
AF-A0A317FJI0-F1-model_v4 glutathione transferase (EC 2.5.1.18) 0.9403 2 210 GO:0004364
GO:0005737
GO:0006749
GO:0043295

Map