F246514

General Info

Members Datasets Scaffolds Average Seq Length
165 113 165 77

Family's Representative Sequence

Representative Sequence 3300031824|Ga0307413_10826815|Ga0307413_108268152
Length 94
Sequence MGTEETGGITGTKDKDYNIIWFVEQCLSNVLRLETYMQDAEREGDSELADFFRRAQGESRKGAEQGQGAVAQAPRWRVRRHHIGPVSDDPRGAA

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
40 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
69 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
70 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
73 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
74 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
75 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
76 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
77 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
78 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
79 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
80 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
81 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
82 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
83 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
84 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
85 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
86 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
87 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
88 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
89 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
90 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
91 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
92 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
93 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
94 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
95 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
96 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
99 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
100 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
101 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
102 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
103 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
104 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
105 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
106 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
107 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
108 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
109 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
110 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.55
Metatranscriptomes 5.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.03
Nodule 0
Rhizoplane 1.21
Rhizosphere 90.91
Stem 0
Stem Tuber 0
Unclassified 4.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10033443 3300003203 Bacteria 1898
2 JGI25407J50210_10006124 3300003373 Bacteria 2984
3 JGI25407J50210_10026360 3300003373 Bacteria 1507
4 Ga0032354_1018721 3300003693 Bacteria 515
5 Ga0068869_100449352 3300005334 Bacteria 1068
6 Ga0068868_100023332 3300005338 Bacteria 4681
7 Ga0070687_100180230 3300005343 Bacteria 1265
8 Ga0070668_100154691 3300005347 Bacteria 1857
9 Ga0070674_100202391 3300005356 Bacteria 1534
10 Ga0070659_100534980 3300005366 Bacteria 1002
11 Ga0070659_101892728 3300005366 Bacteria 535
12 Ga0070663_100170970 3300005455 Bacteria 1680
13 Ga0070681_11384610 3300005458 Bacteria 627
14 Ga0070707_102067600 3300005468 Bacteria 537
15 Ga0070684_100190317 3300005535 Bacteria 1867
16 Ga0068853_101520951 3300005539 Bacteria 648
17 Ga0070693_100753494 3300005547 Bacteria 718
18 Ga0070693_101008318 3300005547 Bacteria 630
19 Ga0068855_100615217 3300005563 Bacteria 1170
20 Ga0070664_100524576 3300005564 Bacteria 1093
21 Ga0068856_100070871 3300005614 Bacteria 3449
22 Ga0070702_100793376 3300005615 Bacteria 732
23 Ga0068852_100222131 3300005616 Bacteria 1797
24 Ga0068852_102070525 3300005616 Bacteria 591
25 Ga0068864_101396770 3300005618 Bacteria 702
26 Ga0068861_100077713 3300005719 Bacteria 2590
27 Ga0068863_102252731 3300005841 Bacteria 555
28 Ga0081538_10001001 3300005981 Bacteria 30067
29 Ga0081538_10001296 3300005981 Bacteria 25915
30 Ga0081538_10001367 3300005981 Bacteria 25112
31 Ga0081538_10002250 3300005981 Bacteria 19107
32 Ga0081538_10006330 3300005981 Bacteria 10451
33 Ga0081538_10010508 3300005981 Bacteria 7590
34 Ga0081538_10019173 3300005981 Bacteria 5099
35 Ga0081538_10036004 3300005981 Bacteria 3239
36 Ga0081538_10076632 3300005981 Bacteria 1806
37 Ga0081538_10155843 3300005981 Bacteria 1025
38 Ga0081539_10000430 3300005985 Bacteria 89313
39 Ga0081539_10032979 3300005985 Bacteria 3161
40 Ga0075365_10016642 3300006038 Bacteria 4477
41 Ga0075364_10364259 3300006051 Bacteria 986
42 Ga0070712_101651777 3300006175 Unclassified 561
43 Ga0075434_100573439 3300006871 Bacteria 1148
44 Ga0075434_101707952 3300006871 Bacteria 637
45 Ga0068865_100789534 3300006881 Bacteria 818
46 Ga0075435_100078491 3300007076 Bacteria 2708
47 Ga0105240_10485333 3300009093 Bacteria 1377
48 Ga0105240_11843616 3300009093 Bacteria 630
49 Ga0105245_10011749 3300009098 Bacteria 7618
50 Ga0114129_11520325 3300009147 Bacteria 822
51 Ga0114129_12950228 3300009147 Bacteria 561
52 Ga0105241_10335827 3300009174 Bacteria 1308
53 Ga0105241_10355154 3300009174 Bacteria 1274
54 Ga0105248_10399832 3300009177 Bacteria 1547
55 Ga0105238_10802350 3300009551 Bacteria 957
56 Ga0105249_10813557 3300009553 Bacteria 999
57 Ga0105032_111955 3300009979 Bacteria 696
58 Ga0105028_112079 3300009993 Bacteria 912
59 Ga0105239_10440958 3300010375 Bacteria 1476
60 Ga0105239_12375323 3300010375 Bacteria 617
61 Ga0105246_10118122 3300011119 Bacteria 1960
62 Ga0157373_11009757 3300013100 Bacteria 621
63 Ga0157369_10536898 3300013105 Bacteria 1209
64 Ga0157369_12593641 3300013105 Bacteria 512
65 Ga0157374_10008218 3300013296 Bacteria 8915
66 Ga0163162_10559349 3300013306 Bacteria 1271
67 Ga0157372_10072715 3300013307 Bacteria 3875
68 Ga0157372_10289760 3300013307 Bacteria 1904
69 Ga0157375_11780450 3300013308 Bacteria 730
70 Ga0163163_10445581 3300014325 Bacteria 1355
71 Ga0163163_10688715 3300014325 Bacteria 1086
72 Ga0157377_10025493 3300014745 Bacteria 3154
73 Ga0157377_10871314 3300014745 Bacteria 670
74 Ga0206349_1115591 3300020075 Bacteria 593
75 Ga0206354_10715567 3300020081 Bacteria 671
76 Ga0206353_10867690 3300020082 Bacteria 667
77 Ga0206353_11327178 3300020082 Bacteria 542
78 Ga0224712_10322843 3300022467 Bacteria 725
79 Ga0207710_10336243 3300025900 Bacteria 767
80 Ga0207688_10650305 3300025901 Bacteria 666
81 Ga0207643_10365441 3300025908 Bacteria 908
82 Ga0207693_10214302 3300025915 Bacteria 1513
83 Ga0207709_10127943 3300025935 Bacteria 1726
84 Ga0207670_10660491 3300025936 Bacteria 863
85 Ga0207669_10114044 3300025937 Bacteria 1818
86 Ga0207711_10416894 3300025941 Bacteria 1249
87 Ga0207668_10393397 3300025972 Bacteria 1170
88 Ga0207678_10583708 3300026067 Bacteria 979
89 Ga0207702_11662068 3300026078 Bacteria 632
90 Ga0207675_100080600 3300026118 Bacteria 3052
91 Ga0207675_100810860 3300026118 Bacteria 950
92 Ga0207683_10232301 3300026121 Bacteria 1682
93 Ga0307515_10109057 3300028794 Bacteria 3255
94 Ga0307413_10826815 3300031824 Bacteria 781
95 Ga0307413_11640057 3300031824 Bacteria 572
96 Ga0307407_10406669 3300031903 Bacteria 978
97 Ga0307409_100337366 3300031995 Bacteria 1417
98 Ga0307409_100355991 3300031995 Bacteria 1383
99 Ga0307415_100004438 3300032126 Bacteria 7276
100 Ga0307415_100456624 3300032126 Bacteria 1106
101 Ga0307415_102222060 3300032126 Bacteria 537
102 Ga0436365_0867185 3300039437 Bacteria 1941
103 Ga0436365_1280913 3300039437 Bacteria 1661
104 Ga0436363_0022472 3300039450 Bacteria 699
105 Ga0436362_0476508 3300039453 Bacteria 4637
106 Ga0436362_1011172 3300039453 Bacteria 1778
107 Ga0451845_0756197 3300041501 Bacteria 658
108 Ga0451849_0593536 3300041505 Bacteria 672
109 Ga0451853_2613687 3300041512 Bacteria 962
110 Ga0451853_3246778 3300041512 Bacteria 524
111 Ga0466965_0138738 3300044683 Bacteria 1265
112 Ga0466966_0009520 3300044684 Bacteria 6434
113 Ga0466966_0066411 3300044684 Bacteria 2267
114 Ga0466966_0085978 3300044684 Bacteria 1955
115 Ga0466961_0019882 3300044693 Bacteria 4322
116 Ga0466963_0013468 3300044694 Bacteria 5022
117 Ga0466963_0070490 3300044694 Bacteria 2351
118 Ga0466963_0523105 3300044694 Bacteria 838
119 Ga0466963_1176641 3300044694 Bacteria 539
120 Ga0466964_0308747 3300044706 Bacteria 800
121 Ga0466964_0466075 3300044706 Bacteria 673
122 Ga0466964_0603686 3300044706 Bacteria 602
123 Ga0466971_0000801 3300044719 Bacteria 12688
124 Ga0466971_0028658 3300044719 Bacteria 2490
125 Ga0466957_0010172 3300044842 Bacteria 5385
126 Ga0466957_0014414 3300044842 Bacteria 4603
127 Ga0466957_1195611 3300044842 Bacteria 550
128 Ga0466960_0218574 3300044901 Bacteria 1048
129 Ga0466960_0937466 3300044901 Bacteria 529
130 Ga0466959_0118632 3300045049 Bacteria 1882
131 Ga0466959_0336706 3300045049 Bacteria 1030
132 Ga0466959_0737575 3300045049 Bacteria 659
133 Ga0466958_0000938 3300045836 Bacteria 13143
134 Ga0466958_0058305 3300045836 Bacteria 2348
135 Ga0466958_0276285 3300045836 Bacteria 1076
136 Ga0466967_0267570 3300045976 Bacteria 1637
137 Ga0466967_0574149 3300045976 Bacteria 1111
138 Ga0466967_1024745 3300045976 Bacteria 822
139 Ga0466967_1251216 3300045976 Bacteria 739
140 Ga0466967_2315163 3300045976 Bacteria 533
141 Ga0495656_0000217 3300046615 Bacteria 20479
142 Ga0495657_0000026 3300046675 Bacteria 133011
143 Ga0495675_0000015 3300047444 Bacteria 133004
144 Ga0495593_0032964 3300047673 Bacteria 2822
145 Ga0496101_0769257 3300048904 Bacteria 760
146 Ga0496103_0452642 3300048906 Bacteria 823
147 Ga0501036_0793883 3300049572 Bacteria 780
148 Ga0501042_0255193 3300049578 Bacteria 1265
149 Ga0501042_0277184 3300049578 Bacteria 1211
150 Ga0501070_0421419 3300049586 Bacteria 1078
151 Ga0501075_0653044 3300049591 Bacteria 802
152 Ga0501076_1199353 3300049592 Bacteria 625
153 Ga0501045_0243396 3300049824 Bacteria 1339
154 nmdc:mga00v17_67719_c1 3300050491 Bacteria 997
155 nmdc:mga0yw44_24344_c1 3300050492 Bacteria 3425
156 nmdc:mga0n895_1458691_c1 3300050512 Bacteria 651
157 Ga0495595_0000017 3300053084 Bacteria 133011
158 Ga0495619_0000101 3300053085 Bacteria 64377
159 Ga0500634_0389019 3300053161 Bacteria 519
160 Ga0501084_0338420 3300054114 Bacteria 1271
161 Ga0590071_152710 3300059421 Bacteria 599
162 Ga0587073_0130929 3300059492 Bacteria 688
163 Ga0587072_194879 3300059643 Bacteria 512
164 Ga0587075_148610 3300059644 Bacteria 505
165 Ga0466962_0005451 3300061719 Bacteria 6114

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_11520325 Ga0114129_115203251 73
2 3300003373 JGI25407J50210_10026360 JGI25407J50210_100263602 74
3 3300005981 Ga0081538_10001296 Ga0081538_100012966 74
4 3300005981 Ga0081538_10036004 Ga0081538_100360044 74
5 3300005985 Ga0081539_10032979 Ga0081539_100329792 74
6 3300006871 Ga0075434_100573439 Ga0075434_1005734393 74
7 3300007076 Ga0075435_100078491 Ga0075435_1000784914 74
8 3300013105 Ga0157369_12593641 Ga0157369_125936412 74
9 3300003693 Ga0032354_1018721 Ga0032354_10187211 75
10 3300005338 Ga0068868_100023332 Ga0068868_1000233326 75
11 3300005356 Ga0070674_100202391 Ga0070674_1002023912 75
12 3300005366 Ga0070659_100534980 Ga0070659_1005349801 75
13 3300005455 Ga0070663_100170970 Ga0070663_1001709702 75
14 3300005535 Ga0070684_100190317 Ga0070684_1001903172 75
15 3300005539 Ga0068853_101520951 Ga0068853_1015209512 75
16 3300005547 Ga0070693_100753494 Ga0070693_1007534941 75
17 3300005563 Ga0068855_100615217 Ga0068855_1006152171 75
18 3300005564 Ga0070664_100524576 Ga0070664_1005245761 75
19 3300005614 Ga0068856_100070871 Ga0068856_1000708712 75
20 3300005616 Ga0068852_100222131 Ga0068852_1002221312 75
21 3300005618 Ga0068864_101396770 Ga0068864_1013967702 75
22 3300005719 Ga0068861_100077713 Ga0068861_1000777132 75
23 3300005841 Ga0068863_102252731 Ga0068863_1022527311 75
24 3300005981 Ga0081538_10019173 Ga0081538_100191734 75
25 3300006871 Ga0075434_101707952 Ga0075434_1017079521 75
26 3300009093 Ga0105240_10485333 Ga0105240_104853332 75
27 3300009093 Ga0105240_11843616 Ga0105240_118436162 75
28 3300009098 Ga0105245_10011749 Ga0105245_100117496 75
29 3300009174 Ga0105241_10335827 Ga0105241_103358272 75
30 3300009174 Ga0105241_10355154 Ga0105241_103551541 75
31 3300009551 Ga0105238_10802350 Ga0105238_108023502 75
32 3300009979 Ga0105032_111955 Ga0105032_1119552 75
33 3300009993 Ga0105028_112079 Ga0105028_1120791 75
34 3300010375 Ga0105239_10440958 Ga0105239_104409583 75
35 3300013105 Ga0157369_10536898 Ga0157369_105368982 75
36 3300013296 Ga0157374_10008218 Ga0157374_100082184 75
37 3300013307 Ga0157372_10072715 Ga0157372_100727154 75
38 3300013307 Ga0157372_10289760 Ga0157372_102897602 75
39 3300014325 Ga0163163_10688715 Ga0163163_106887151 75
40 3300014745 Ga0157377_10025493 Ga0157377_100254931 75
41 3300014745 Ga0157377_10871314 Ga0157377_108713141 75
42 3300020075 Ga0206349_1115591 Ga0206349_11155911 75
43 3300020082 Ga0206353_11327178 Ga0206353_113271781 75
44 3300025901 Ga0207688_10650305 Ga0207688_106503051 75
45 3300025915 Ga0207693_10214302 Ga0207693_102143022 75
46 3300025935 Ga0207709_10127943 Ga0207709_101279432 75
47 3300025937 Ga0207669_10114044 Ga0207669_101140444 75
48 3300025972 Ga0207668_10393397 Ga0207668_103933972 75
49 3300026067 Ga0207678_10583708 Ga0207678_105837082 75
50 3300026118 Ga0207675_100080600 Ga0207675_1000806002 75
51 3300026121 Ga0207683_10232301 Ga0207683_102323014 75
52 3300028794 Ga0307515_10109057 Ga0307515_101090575 75
53 3300031824 Ga0307413_10826815 Ga0307413_108268152 75
54 3300031824 Ga0307413_11640057 Ga0307413_116400572 75
55 3300031995 Ga0307409_100337366 Ga0307409_1003373662 75
56 3300032126 Ga0307415_100004438 Ga0307415_1000044387 75
57 3300032126 Ga0307415_100456624 Ga0307415_1004566241 75
58 3300032126 Ga0307415_102222060 Ga0307415_1022220602 75
59 3300041512 Ga0451853_3246778 Ga0451853_3246778_258_488 75
60 3300044694 Ga0466963_0070490 Ga0466963_0070490_1110_1340 75
61 3300044842 Ga0466957_1195611 Ga0466957_1195611_309_539 75
62 3300045836 Ga0466958_0058305 Ga0466958_0058305_1421_1651 75
63 3300045976 Ga0466967_0267570 Ga0466967_0267570_772_1002 75
64 3300045976 Ga0466967_1251216 Ga0466967_1251216_237_467 75
65 3300045976 Ga0466967_2315163 Ga0466967_2315163_32_262 75
66 3300046675 Ga0495657_0000026 Ga0495657_0000026_61693_61923 75
67 3300047444 Ga0495675_0000015 Ga0495675_0000015_61686_61916 75
68 3300047673 Ga0495593_0032964 Ga0495593_0032964_1186_1416 75
69 3300049578 Ga0501042_0255193 Ga0501042_0255193_448_678 75
70 3300050512 nmdc:mga0n895_1458691_c1 nmdc:mga0n895_1458691_c1_222_452 75
71 3300053084 Ga0495595_0000017 Ga0495595_0000017_61693_61923 75
72 3300053085 Ga0495619_0000101 Ga0495619_0000101_61693_61923 75
73 3300053161 Ga0500634_0389019 Ga0500634_0389019_128_358 75
74 3300059421 Ga0590071_152710 Ga0590071_152710_169_399 75
75 3300003203 JGI25406J46586_10033443 JGI25406J46586_100334432 76
76 3300003373 JGI25407J50210_10006124 JGI25407J50210_100061243 76
77 3300005334 Ga0068869_100449352 Ga0068869_1004493522 76
78 3300005343 Ga0070687_100180230 Ga0070687_1001802304 76
79 3300005347 Ga0070668_100154691 Ga0070668_1001546913 76
80 3300005366 Ga0070659_101892728 Ga0070659_1018927281 76
81 3300005458 Ga0070681_11384610 Ga0070681_113846102 76
82 3300005468 Ga0070707_102067600 Ga0070707_1020676001 76
83 3300005547 Ga0070693_101008318 Ga0070693_1010083181 76
84 3300005615 Ga0070702_100793376 Ga0070702_1007933762 76
85 3300005616 Ga0068852_102070525 Ga0068852_1020705252 76
86 3300005981 Ga0081538_10001001 Ga0081538_1000100120 76
87 3300005981 Ga0081538_10001367 Ga0081538_100013675 76
88 3300005981 Ga0081538_10002250 Ga0081538_1000225017 76
89 3300005981 Ga0081538_10006330 Ga0081538_100063302 76
90 3300005981 Ga0081538_10010508 Ga0081538_100105084 76
91 3300005981 Ga0081538_10076632 Ga0081538_100766321 76
92 3300005981 Ga0081538_10155843 Ga0081538_101558433 76
93 3300005985 Ga0081539_10000430 Ga0081539_1000043038 76
94 3300006038 Ga0075365_10016642 Ga0075365_100166422 76
95 3300006051 Ga0075364_10364259 Ga0075364_103642593 76
96 3300006175 Ga0070712_101651777 Ga0070712_1016517771 76
97 3300006881 Ga0068865_100789534 Ga0068865_1007895341 76
98 3300009147 Ga0114129_12950228 Ga0114129_129502282 76
99 3300009177 Ga0105248_10399832 Ga0105248_103998323 76
100 3300009553 Ga0105249_10813557 Ga0105249_108135571 76
101 3300010375 Ga0105239_12375323 Ga0105239_123753231 76
102 3300011119 Ga0105246_10118122 Ga0105246_101181223 76
103 3300013100 Ga0157373_11009757 Ga0157373_110097572 76
104 3300013306 Ga0163162_10559349 Ga0163162_105593492 76
105 3300013308 Ga0157375_11780450 Ga0157375_117804502 76
106 3300014325 Ga0163163_10445581 Ga0163163_104455812 76
107 3300020081 Ga0206354_10715567 Ga0206354_107155672 76
108 3300020082 Ga0206353_10867690 Ga0206353_108676902 76
109 3300022467 Ga0224712_10322843 Ga0224712_103228432 76
110 3300025900 Ga0207710_10336243 Ga0207710_103362432 76
111 3300025908 Ga0207643_10365441 Ga0207643_103654411 76
112 3300025936 Ga0207670_10660491 Ga0207670_106604912 76
113 3300025941 Ga0207711_10416894 Ga0207711_104168943 76
114 3300026078 Ga0207702_11662068 Ga0207702_116620681 76
115 3300026118 Ga0207675_100810860 Ga0207675_1008108601 76
116 3300031903 Ga0307407_10406669 Ga0307407_104066692 76
117 3300031995 Ga0307409_100355991 Ga0307409_1003559912 76
118 3300039437 Ga0436365_0867185 Ga0436365_0867185_984_1220 76
119 3300039437 Ga0436365_1280913 Ga0436365_1280913_125_361 76
120 3300039450 Ga0436363_0022472 Ga0436363_0022472_98_334 76
121 3300039453 Ga0436362_0476508 Ga0436362_0476508_2255_2491 76
122 3300039453 Ga0436362_1011172 Ga0436362_1011172_322_558 76
123 3300041501 Ga0451845_0756197 Ga0451845_0756197_355_636 76
124 3300041505 Ga0451849_0593536 Ga0451849_0593536_90_326 76
125 3300041512 Ga0451853_2613687 Ga0451853_2613687_483_719 76
126 3300044683 Ga0466965_0138738 Ga0466965_0138738_500_733 76
127 3300044684 Ga0466966_0009520 Ga0466966_0009520_5548_5784 76
128 3300044684 Ga0466966_0066411 Ga0466966_0066411_855_1091 76
129 3300044684 Ga0466966_0085978 Ga0466966_0085978_593_829 76
130 3300044693 Ga0466961_0019882 Ga0466961_0019882_4065_4301 76
131 3300044694 Ga0466963_0013468 Ga0466963_0013468_4547_4783 76
132 3300044694 Ga0466963_0523105 Ga0466963_0523105_374_610 76
133 3300044694 Ga0466963_1176641 Ga0466963_1176641_134_367 76
134 3300044706 Ga0466964_0308747 Ga0466964_0308747_383_619 76
135 3300044706 Ga0466964_0466075 Ga0466964_0466075_111_344 76
136 3300044706 Ga0466964_0603686 Ga0466964_0603686_141_380 76
137 3300044719 Ga0466971_0000801 Ga0466971_0000801_46_282 76
138 3300044719 Ga0466971_0028658 Ga0466971_0028658_214_450 76
139 3300044842 Ga0466957_0010172 Ga0466957_0010172_2011_2247 76
140 3300044842 Ga0466957_0014414 Ga0466957_0014414_68_304 76
141 3300044901 Ga0466960_0218574 Ga0466960_0218574_271_510 76
142 3300044901 Ga0466960_0937466 Ga0466960_0937466_25_264 76
143 3300045049 Ga0466959_0118632 Ga0466959_0118632_240_476 76
144 3300045049 Ga0466959_0336706 Ga0466959_0336706_644_880 76
145 3300045049 Ga0466959_0737575 Ga0466959_0737575_373_606 76
146 3300045836 Ga0466958_0000938 Ga0466958_0000938_11923_12159 76
147 3300045836 Ga0466958_0276285 Ga0466958_0276285_381_617 76
148 3300045976 Ga0466967_0574149 Ga0466967_0574149_50_283 76
149 3300045976 Ga0466967_1024745 Ga0466967_1024745_526_759 76
150 3300046615 Ga0495656_0000217 Ga0495656_0000217_992_1225 76
151 3300048904 Ga0496101_0769257 Ga0496101_0769257_296_529 76
152 3300048906 Ga0496103_0452642 Ga0496103_0452642_66_299 76
153 3300049572 Ga0501036_0793883 Ga0501036_0793883_263_496 76
154 3300049578 Ga0501042_0277184 Ga0501042_0277184_528_761 76
155 3300049586 Ga0501070_0421419 Ga0501070_0421419_763_996 76
156 3300049591 Ga0501075_0653044 Ga0501075_0653044_457_690 76
157 3300049592 Ga0501076_1199353 Ga0501076_1199353_228_461 76
158 3300049824 Ga0501045_0243396 Ga0501045_0243396_1056_1289 76
159 3300050491 nmdc:mga00v17_67719_c1 nmdc:mga00v17_67719_c1_583_819 76
160 3300050492 nmdc:mga0yw44_24344_c1 nmdc:mga0yw44_24344_c1_3140_3376 76
161 3300054114 Ga0501084_0338420 Ga0501084_0338420_178_411 76
162 3300059492 Ga0587073_0130929 Ga0587073_0130929_54_290 76
163 3300059643 Ga0587072_194879 Ga0587072_194879_64_300 76
164 3300059644 Ga0587075_148610 Ga0587075_148610_17_250 76
165 3300061719 Ga0466962_0005451 Ga0466962_0005451_3225_3461 76

Structural Annotation

Top 5 Hits

ID Description Score Start End
6e8g-assembly1.cif.gz_T cryoem reconstruction of ist1-chmp1b copolymer filament bound to ssdna at 2.9 angstrom resolution 0.9818 17 73
2hr5-assembly1.cif.gz_A pf1283- rubrerythrin from pyrococcus furiosus iron bound form 0.9789 16 71
2d5k-assembly1.cif.gz_B crystal structure of dps from staphylococcus aureus 0.978 17 71
5l8b-assembly2.cif.gz_Q crystal structure of rhodospirillum rubrum rru_a0973 mutant e62a 0.9768 16 73
5l8f-assembly1.cif.gz_C crystal structure of rhodospirillum rubrum rru_a0973 mutant e32a, e62a, h65a. 0.9765 16 73
ID Description Score Start End Superfamily
3qvdE01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.981 16 71 1.20.1260.10
3qvdF01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9807 16 71 1.20.1260.10
1nnqA01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9803 16 71 1.20.1260.10
3qvdG01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9798 16 71 1.20.1260.10
3pwfA01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9797 16 71 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A3D2JBZ2-F1-model_v4 Ferritin-like diiron domain-containing protein 1.003 17 75
AF-A0A2M7SUK7-F1-model_v4 Uncharacterized protein 1.001 17 73
AF-T0MSD6-F1-model_v4 Rubrerythrin diiron-binding domain-containing protein 0.9999 17 73
AF-A0A2X2BWU6-F1-model_v4 protein-glutamate methylesterase (EC 3.1.1.61) 0.9987 16 76 GO:0000156
GO:0005737
GO:0006935
GO:0008984
AF-A0A804PWI0-F1-model_v4 Uncharacterized protein 0.9973 17 73 GO:0007034

Feature Viewer

pLDDT pTM Quality
90.01 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map