F246514
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 165 | 113 | 165 | 77 |
Family's Representative Sequence
| Representative Sequence | 3300031824|Ga0307413_10826815|Ga0307413_108268152 |
| Length | 94 |
| Sequence | MGTEETGGITGTKDKDYNIIWFVEQCLSNVLRLETYMQDAEREGDSELADFFRRAQGESRKGAEQGQGAVAQAPRWRVRRHHIGPVSDDPRGAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 15 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 17 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 19 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 21 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 22 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 23 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 24 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 25 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 26 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 27 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 28 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 30 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 31 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 32 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 40 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 41 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 52 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 53 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 54 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 55 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 69 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 70 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 71 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 72 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 73 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 74 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 75 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 76 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 77 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 78 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 79 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 80 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 81 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 82 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 83 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 84 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 85 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 86 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 87 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 88 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 89 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 90 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 95 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 96 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 97 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 98 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 99 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 100 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 101 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 102 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 103 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 104 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 105 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 108 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 109 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 110 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 111 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 112 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 113 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.55 |
| Metatranscriptomes | 5.45 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.03 |
| Nodule | 0 |
| Rhizoplane | 1.21 |
| Rhizosphere | 90.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.85 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10033443 | 3300003203 | Bacteria | 1898 |
| 2 | JGI25407J50210_10006124 | 3300003373 | Bacteria | 2984 |
| 3 | JGI25407J50210_10026360 | 3300003373 | Bacteria | 1507 |
| 4 | Ga0032354_1018721 | 3300003693 | Bacteria | 515 |
| 5 | Ga0068869_100449352 | 3300005334 | Bacteria | 1068 |
| 6 | Ga0068868_100023332 | 3300005338 | Bacteria | 4681 |
| 7 | Ga0070687_100180230 | 3300005343 | Bacteria | 1265 |
| 8 | Ga0070668_100154691 | 3300005347 | Bacteria | 1857 |
| 9 | Ga0070674_100202391 | 3300005356 | Bacteria | 1534 |
| 10 | Ga0070659_100534980 | 3300005366 | Bacteria | 1002 |
| 11 | Ga0070659_101892728 | 3300005366 | Bacteria | 535 |
| 12 | Ga0070663_100170970 | 3300005455 | Bacteria | 1680 |
| 13 | Ga0070681_11384610 | 3300005458 | Bacteria | 627 |
| 14 | Ga0070707_102067600 | 3300005468 | Bacteria | 537 |
| 15 | Ga0070684_100190317 | 3300005535 | Bacteria | 1867 |
| 16 | Ga0068853_101520951 | 3300005539 | Bacteria | 648 |
| 17 | Ga0070693_100753494 | 3300005547 | Bacteria | 718 |
| 18 | Ga0070693_101008318 | 3300005547 | Bacteria | 630 |
| 19 | Ga0068855_100615217 | 3300005563 | Bacteria | 1170 |
| 20 | Ga0070664_100524576 | 3300005564 | Bacteria | 1093 |
| 21 | Ga0068856_100070871 | 3300005614 | Bacteria | 3449 |
| 22 | Ga0070702_100793376 | 3300005615 | Bacteria | 732 |
| 23 | Ga0068852_100222131 | 3300005616 | Bacteria | 1797 |
| 24 | Ga0068852_102070525 | 3300005616 | Bacteria | 591 |
| 25 | Ga0068864_101396770 | 3300005618 | Bacteria | 702 |
| 26 | Ga0068861_100077713 | 3300005719 | Bacteria | 2590 |
| 27 | Ga0068863_102252731 | 3300005841 | Bacteria | 555 |
| 28 | Ga0081538_10001001 | 3300005981 | Bacteria | 30067 |
| 29 | Ga0081538_10001296 | 3300005981 | Bacteria | 25915 |
| 30 | Ga0081538_10001367 | 3300005981 | Bacteria | 25112 |
| 31 | Ga0081538_10002250 | 3300005981 | Bacteria | 19107 |
| 32 | Ga0081538_10006330 | 3300005981 | Bacteria | 10451 |
| 33 | Ga0081538_10010508 | 3300005981 | Bacteria | 7590 |
| 34 | Ga0081538_10019173 | 3300005981 | Bacteria | 5099 |
| 35 | Ga0081538_10036004 | 3300005981 | Bacteria | 3239 |
| 36 | Ga0081538_10076632 | 3300005981 | Bacteria | 1806 |
| 37 | Ga0081538_10155843 | 3300005981 | Bacteria | 1025 |
| 38 | Ga0081539_10000430 | 3300005985 | Bacteria | 89313 |
| 39 | Ga0081539_10032979 | 3300005985 | Bacteria | 3161 |
| 40 | Ga0075365_10016642 | 3300006038 | Bacteria | 4477 |
| 41 | Ga0075364_10364259 | 3300006051 | Bacteria | 986 |
| 42 | Ga0070712_101651777 | 3300006175 | Unclassified | 561 |
| 43 | Ga0075434_100573439 | 3300006871 | Bacteria | 1148 |
| 44 | Ga0075434_101707952 | 3300006871 | Bacteria | 637 |
| 45 | Ga0068865_100789534 | 3300006881 | Bacteria | 818 |
| 46 | Ga0075435_100078491 | 3300007076 | Bacteria | 2708 |
| 47 | Ga0105240_10485333 | 3300009093 | Bacteria | 1377 |
| 48 | Ga0105240_11843616 | 3300009093 | Bacteria | 630 |
| 49 | Ga0105245_10011749 | 3300009098 | Bacteria | 7618 |
| 50 | Ga0114129_11520325 | 3300009147 | Bacteria | 822 |
| 51 | Ga0114129_12950228 | 3300009147 | Bacteria | 561 |
| 52 | Ga0105241_10335827 | 3300009174 | Bacteria | 1308 |
| 53 | Ga0105241_10355154 | 3300009174 | Bacteria | 1274 |
| 54 | Ga0105248_10399832 | 3300009177 | Bacteria | 1547 |
| 55 | Ga0105238_10802350 | 3300009551 | Bacteria | 957 |
| 56 | Ga0105249_10813557 | 3300009553 | Bacteria | 999 |
| 57 | Ga0105032_111955 | 3300009979 | Bacteria | 696 |
| 58 | Ga0105028_112079 | 3300009993 | Bacteria | 912 |
| 59 | Ga0105239_10440958 | 3300010375 | Bacteria | 1476 |
| 60 | Ga0105239_12375323 | 3300010375 | Bacteria | 617 |
| 61 | Ga0105246_10118122 | 3300011119 | Bacteria | 1960 |
| 62 | Ga0157373_11009757 | 3300013100 | Bacteria | 621 |
| 63 | Ga0157369_10536898 | 3300013105 | Bacteria | 1209 |
| 64 | Ga0157369_12593641 | 3300013105 | Bacteria | 512 |
| 65 | Ga0157374_10008218 | 3300013296 | Bacteria | 8915 |
| 66 | Ga0163162_10559349 | 3300013306 | Bacteria | 1271 |
| 67 | Ga0157372_10072715 | 3300013307 | Bacteria | 3875 |
| 68 | Ga0157372_10289760 | 3300013307 | Bacteria | 1904 |
| 69 | Ga0157375_11780450 | 3300013308 | Bacteria | 730 |
| 70 | Ga0163163_10445581 | 3300014325 | Bacteria | 1355 |
| 71 | Ga0163163_10688715 | 3300014325 | Bacteria | 1086 |
| 72 | Ga0157377_10025493 | 3300014745 | Bacteria | 3154 |
| 73 | Ga0157377_10871314 | 3300014745 | Bacteria | 670 |
| 74 | Ga0206349_1115591 | 3300020075 | Bacteria | 593 |
| 75 | Ga0206354_10715567 | 3300020081 | Bacteria | 671 |
| 76 | Ga0206353_10867690 | 3300020082 | Bacteria | 667 |
| 77 | Ga0206353_11327178 | 3300020082 | Bacteria | 542 |
| 78 | Ga0224712_10322843 | 3300022467 | Bacteria | 725 |
| 79 | Ga0207710_10336243 | 3300025900 | Bacteria | 767 |
| 80 | Ga0207688_10650305 | 3300025901 | Bacteria | 666 |
| 81 | Ga0207643_10365441 | 3300025908 | Bacteria | 908 |
| 82 | Ga0207693_10214302 | 3300025915 | Bacteria | 1513 |
| 83 | Ga0207709_10127943 | 3300025935 | Bacteria | 1726 |
| 84 | Ga0207670_10660491 | 3300025936 | Bacteria | 863 |
| 85 | Ga0207669_10114044 | 3300025937 | Bacteria | 1818 |
| 86 | Ga0207711_10416894 | 3300025941 | Bacteria | 1249 |
| 87 | Ga0207668_10393397 | 3300025972 | Bacteria | 1170 |
| 88 | Ga0207678_10583708 | 3300026067 | Bacteria | 979 |
| 89 | Ga0207702_11662068 | 3300026078 | Bacteria | 632 |
| 90 | Ga0207675_100080600 | 3300026118 | Bacteria | 3052 |
| 91 | Ga0207675_100810860 | 3300026118 | Bacteria | 950 |
| 92 | Ga0207683_10232301 | 3300026121 | Bacteria | 1682 |
| 93 | Ga0307515_10109057 | 3300028794 | Bacteria | 3255 |
| 94 | Ga0307413_10826815 | 3300031824 | Bacteria | 781 |
| 95 | Ga0307413_11640057 | 3300031824 | Bacteria | 572 |
| 96 | Ga0307407_10406669 | 3300031903 | Bacteria | 978 |
| 97 | Ga0307409_100337366 | 3300031995 | Bacteria | 1417 |
| 98 | Ga0307409_100355991 | 3300031995 | Bacteria | 1383 |
| 99 | Ga0307415_100004438 | 3300032126 | Bacteria | 7276 |
| 100 | Ga0307415_100456624 | 3300032126 | Bacteria | 1106 |
| 101 | Ga0307415_102222060 | 3300032126 | Bacteria | 537 |
| 102 | Ga0436365_0867185 | 3300039437 | Bacteria | 1941 |
| 103 | Ga0436365_1280913 | 3300039437 | Bacteria | 1661 |
| 104 | Ga0436363_0022472 | 3300039450 | Bacteria | 699 |
| 105 | Ga0436362_0476508 | 3300039453 | Bacteria | 4637 |
| 106 | Ga0436362_1011172 | 3300039453 | Bacteria | 1778 |
| 107 | Ga0451845_0756197 | 3300041501 | Bacteria | 658 |
| 108 | Ga0451849_0593536 | 3300041505 | Bacteria | 672 |
| 109 | Ga0451853_2613687 | 3300041512 | Bacteria | 962 |
| 110 | Ga0451853_3246778 | 3300041512 | Bacteria | 524 |
| 111 | Ga0466965_0138738 | 3300044683 | Bacteria | 1265 |
| 112 | Ga0466966_0009520 | 3300044684 | Bacteria | 6434 |
| 113 | Ga0466966_0066411 | 3300044684 | Bacteria | 2267 |
| 114 | Ga0466966_0085978 | 3300044684 | Bacteria | 1955 |
| 115 | Ga0466961_0019882 | 3300044693 | Bacteria | 4322 |
| 116 | Ga0466963_0013468 | 3300044694 | Bacteria | 5022 |
| 117 | Ga0466963_0070490 | 3300044694 | Bacteria | 2351 |
| 118 | Ga0466963_0523105 | 3300044694 | Bacteria | 838 |
| 119 | Ga0466963_1176641 | 3300044694 | Bacteria | 539 |
| 120 | Ga0466964_0308747 | 3300044706 | Bacteria | 800 |
| 121 | Ga0466964_0466075 | 3300044706 | Bacteria | 673 |
| 122 | Ga0466964_0603686 | 3300044706 | Bacteria | 602 |
| 123 | Ga0466971_0000801 | 3300044719 | Bacteria | 12688 |
| 124 | Ga0466971_0028658 | 3300044719 | Bacteria | 2490 |
| 125 | Ga0466957_0010172 | 3300044842 | Bacteria | 5385 |
| 126 | Ga0466957_0014414 | 3300044842 | Bacteria | 4603 |
| 127 | Ga0466957_1195611 | 3300044842 | Bacteria | 550 |
| 128 | Ga0466960_0218574 | 3300044901 | Bacteria | 1048 |
| 129 | Ga0466960_0937466 | 3300044901 | Bacteria | 529 |
| 130 | Ga0466959_0118632 | 3300045049 | Bacteria | 1882 |
| 131 | Ga0466959_0336706 | 3300045049 | Bacteria | 1030 |
| 132 | Ga0466959_0737575 | 3300045049 | Bacteria | 659 |
| 133 | Ga0466958_0000938 | 3300045836 | Bacteria | 13143 |
| 134 | Ga0466958_0058305 | 3300045836 | Bacteria | 2348 |
| 135 | Ga0466958_0276285 | 3300045836 | Bacteria | 1076 |
| 136 | Ga0466967_0267570 | 3300045976 | Bacteria | 1637 |
| 137 | Ga0466967_0574149 | 3300045976 | Bacteria | 1111 |
| 138 | Ga0466967_1024745 | 3300045976 | Bacteria | 822 |
| 139 | Ga0466967_1251216 | 3300045976 | Bacteria | 739 |
| 140 | Ga0466967_2315163 | 3300045976 | Bacteria | 533 |
| 141 | Ga0495656_0000217 | 3300046615 | Bacteria | 20479 |
| 142 | Ga0495657_0000026 | 3300046675 | Bacteria | 133011 |
| 143 | Ga0495675_0000015 | 3300047444 | Bacteria | 133004 |
| 144 | Ga0495593_0032964 | 3300047673 | Bacteria | 2822 |
| 145 | Ga0496101_0769257 | 3300048904 | Bacteria | 760 |
| 146 | Ga0496103_0452642 | 3300048906 | Bacteria | 823 |
| 147 | Ga0501036_0793883 | 3300049572 | Bacteria | 780 |
| 148 | Ga0501042_0255193 | 3300049578 | Bacteria | 1265 |
| 149 | Ga0501042_0277184 | 3300049578 | Bacteria | 1211 |
| 150 | Ga0501070_0421419 | 3300049586 | Bacteria | 1078 |
| 151 | Ga0501075_0653044 | 3300049591 | Bacteria | 802 |
| 152 | Ga0501076_1199353 | 3300049592 | Bacteria | 625 |
| 153 | Ga0501045_0243396 | 3300049824 | Bacteria | 1339 |
| 154 | nmdc:mga00v17_67719_c1 | 3300050491 | Bacteria | 997 |
| 155 | nmdc:mga0yw44_24344_c1 | 3300050492 | Bacteria | 3425 |
| 156 | nmdc:mga0n895_1458691_c1 | 3300050512 | Bacteria | 651 |
| 157 | Ga0495595_0000017 | 3300053084 | Bacteria | 133011 |
| 158 | Ga0495619_0000101 | 3300053085 | Bacteria | 64377 |
| 159 | Ga0500634_0389019 | 3300053161 | Bacteria | 519 |
| 160 | Ga0501084_0338420 | 3300054114 | Bacteria | 1271 |
| 161 | Ga0590071_152710 | 3300059421 | Bacteria | 599 |
| 162 | Ga0587073_0130929 | 3300059492 | Bacteria | 688 |
| 163 | Ga0587072_194879 | 3300059643 | Bacteria | 512 |
| 164 | Ga0587075_148610 | 3300059644 | Bacteria | 505 |
| 165 | Ga0466962_0005451 | 3300061719 | Bacteria | 6114 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009147 | Ga0114129_11520325 | Ga0114129_115203251 | 73 |
| 2 | 3300003373 | JGI25407J50210_10026360 | JGI25407J50210_100263602 | 74 |
| 3 | 3300005981 | Ga0081538_10001296 | Ga0081538_100012966 | 74 |
| 4 | 3300005981 | Ga0081538_10036004 | Ga0081538_100360044 | 74 |
| 5 | 3300005985 | Ga0081539_10032979 | Ga0081539_100329792 | 74 |
| 6 | 3300006871 | Ga0075434_100573439 | Ga0075434_1005734393 | 74 |
| 7 | 3300007076 | Ga0075435_100078491 | Ga0075435_1000784914 | 74 |
| 8 | 3300013105 | Ga0157369_12593641 | Ga0157369_125936412 | 74 |
| 9 | 3300003693 | Ga0032354_1018721 | Ga0032354_10187211 | 75 |
| 10 | 3300005338 | Ga0068868_100023332 | Ga0068868_1000233326 | 75 |
| 11 | 3300005356 | Ga0070674_100202391 | Ga0070674_1002023912 | 75 |
| 12 | 3300005366 | Ga0070659_100534980 | Ga0070659_1005349801 | 75 |
| 13 | 3300005455 | Ga0070663_100170970 | Ga0070663_1001709702 | 75 |
| 14 | 3300005535 | Ga0070684_100190317 | Ga0070684_1001903172 | 75 |
| 15 | 3300005539 | Ga0068853_101520951 | Ga0068853_1015209512 | 75 |
| 16 | 3300005547 | Ga0070693_100753494 | Ga0070693_1007534941 | 75 |
| 17 | 3300005563 | Ga0068855_100615217 | Ga0068855_1006152171 | 75 |
| 18 | 3300005564 | Ga0070664_100524576 | Ga0070664_1005245761 | 75 |
| 19 | 3300005614 | Ga0068856_100070871 | Ga0068856_1000708712 | 75 |
| 20 | 3300005616 | Ga0068852_100222131 | Ga0068852_1002221312 | 75 |
| 21 | 3300005618 | Ga0068864_101396770 | Ga0068864_1013967702 | 75 |
| 22 | 3300005719 | Ga0068861_100077713 | Ga0068861_1000777132 | 75 |
| 23 | 3300005841 | Ga0068863_102252731 | Ga0068863_1022527311 | 75 |
| 24 | 3300005981 | Ga0081538_10019173 | Ga0081538_100191734 | 75 |
| 25 | 3300006871 | Ga0075434_101707952 | Ga0075434_1017079521 | 75 |
| 26 | 3300009093 | Ga0105240_10485333 | Ga0105240_104853332 | 75 |
| 27 | 3300009093 | Ga0105240_11843616 | Ga0105240_118436162 | 75 |
| 28 | 3300009098 | Ga0105245_10011749 | Ga0105245_100117496 | 75 |
| 29 | 3300009174 | Ga0105241_10335827 | Ga0105241_103358272 | 75 |
| 30 | 3300009174 | Ga0105241_10355154 | Ga0105241_103551541 | 75 |
| 31 | 3300009551 | Ga0105238_10802350 | Ga0105238_108023502 | 75 |
| 32 | 3300009979 | Ga0105032_111955 | Ga0105032_1119552 | 75 |
| 33 | 3300009993 | Ga0105028_112079 | Ga0105028_1120791 | 75 |
| 34 | 3300010375 | Ga0105239_10440958 | Ga0105239_104409583 | 75 |
| 35 | 3300013105 | Ga0157369_10536898 | Ga0157369_105368982 | 75 |
| 36 | 3300013296 | Ga0157374_10008218 | Ga0157374_100082184 | 75 |
| 37 | 3300013307 | Ga0157372_10072715 | Ga0157372_100727154 | 75 |
| 38 | 3300013307 | Ga0157372_10289760 | Ga0157372_102897602 | 75 |
| 39 | 3300014325 | Ga0163163_10688715 | Ga0163163_106887151 | 75 |
| 40 | 3300014745 | Ga0157377_10025493 | Ga0157377_100254931 | 75 |
| 41 | 3300014745 | Ga0157377_10871314 | Ga0157377_108713141 | 75 |
| 42 | 3300020075 | Ga0206349_1115591 | Ga0206349_11155911 | 75 |
| 43 | 3300020082 | Ga0206353_11327178 | Ga0206353_113271781 | 75 |
| 44 | 3300025901 | Ga0207688_10650305 | Ga0207688_106503051 | 75 |
| 45 | 3300025915 | Ga0207693_10214302 | Ga0207693_102143022 | 75 |
| 46 | 3300025935 | Ga0207709_10127943 | Ga0207709_101279432 | 75 |
| 47 | 3300025937 | Ga0207669_10114044 | Ga0207669_101140444 | 75 |
| 48 | 3300025972 | Ga0207668_10393397 | Ga0207668_103933972 | 75 |
| 49 | 3300026067 | Ga0207678_10583708 | Ga0207678_105837082 | 75 |
| 50 | 3300026118 | Ga0207675_100080600 | Ga0207675_1000806002 | 75 |
| 51 | 3300026121 | Ga0207683_10232301 | Ga0207683_102323014 | 75 |
| 52 | 3300028794 | Ga0307515_10109057 | Ga0307515_101090575 | 75 |
| 53 | 3300031824 | Ga0307413_10826815 | Ga0307413_108268152 | 75 |
| 54 | 3300031824 | Ga0307413_11640057 | Ga0307413_116400572 | 75 |
| 55 | 3300031995 | Ga0307409_100337366 | Ga0307409_1003373662 | 75 |
| 56 | 3300032126 | Ga0307415_100004438 | Ga0307415_1000044387 | 75 |
| 57 | 3300032126 | Ga0307415_100456624 | Ga0307415_1004566241 | 75 |
| 58 | 3300032126 | Ga0307415_102222060 | Ga0307415_1022220602 | 75 |
| 59 | 3300041512 | Ga0451853_3246778 | Ga0451853_3246778_258_488 | 75 |
| 60 | 3300044694 | Ga0466963_0070490 | Ga0466963_0070490_1110_1340 | 75 |
| 61 | 3300044842 | Ga0466957_1195611 | Ga0466957_1195611_309_539 | 75 |
| 62 | 3300045836 | Ga0466958_0058305 | Ga0466958_0058305_1421_1651 | 75 |
| 63 | 3300045976 | Ga0466967_0267570 | Ga0466967_0267570_772_1002 | 75 |
| 64 | 3300045976 | Ga0466967_1251216 | Ga0466967_1251216_237_467 | 75 |
| 65 | 3300045976 | Ga0466967_2315163 | Ga0466967_2315163_32_262 | 75 |
| 66 | 3300046675 | Ga0495657_0000026 | Ga0495657_0000026_61693_61923 | 75 |
| 67 | 3300047444 | Ga0495675_0000015 | Ga0495675_0000015_61686_61916 | 75 |
| 68 | 3300047673 | Ga0495593_0032964 | Ga0495593_0032964_1186_1416 | 75 |
| 69 | 3300049578 | Ga0501042_0255193 | Ga0501042_0255193_448_678 | 75 |
| 70 | 3300050512 | nmdc:mga0n895_1458691_c1 | nmdc:mga0n895_1458691_c1_222_452 | 75 |
| 71 | 3300053084 | Ga0495595_0000017 | Ga0495595_0000017_61693_61923 | 75 |
| 72 | 3300053085 | Ga0495619_0000101 | Ga0495619_0000101_61693_61923 | 75 |
| 73 | 3300053161 | Ga0500634_0389019 | Ga0500634_0389019_128_358 | 75 |
| 74 | 3300059421 | Ga0590071_152710 | Ga0590071_152710_169_399 | 75 |
| 75 | 3300003203 | JGI25406J46586_10033443 | JGI25406J46586_100334432 | 76 |
| 76 | 3300003373 | JGI25407J50210_10006124 | JGI25407J50210_100061243 | 76 |
| 77 | 3300005334 | Ga0068869_100449352 | Ga0068869_1004493522 | 76 |
| 78 | 3300005343 | Ga0070687_100180230 | Ga0070687_1001802304 | 76 |
| 79 | 3300005347 | Ga0070668_100154691 | Ga0070668_1001546913 | 76 |
| 80 | 3300005366 | Ga0070659_101892728 | Ga0070659_1018927281 | 76 |
| 81 | 3300005458 | Ga0070681_11384610 | Ga0070681_113846102 | 76 |
| 82 | 3300005468 | Ga0070707_102067600 | Ga0070707_1020676001 | 76 |
| 83 | 3300005547 | Ga0070693_101008318 | Ga0070693_1010083181 | 76 |
| 84 | 3300005615 | Ga0070702_100793376 | Ga0070702_1007933762 | 76 |
| 85 | 3300005616 | Ga0068852_102070525 | Ga0068852_1020705252 | 76 |
| 86 | 3300005981 | Ga0081538_10001001 | Ga0081538_1000100120 | 76 |
| 87 | 3300005981 | Ga0081538_10001367 | Ga0081538_100013675 | 76 |
| 88 | 3300005981 | Ga0081538_10002250 | Ga0081538_1000225017 | 76 |
| 89 | 3300005981 | Ga0081538_10006330 | Ga0081538_100063302 | 76 |
| 90 | 3300005981 | Ga0081538_10010508 | Ga0081538_100105084 | 76 |
| 91 | 3300005981 | Ga0081538_10076632 | Ga0081538_100766321 | 76 |
| 92 | 3300005981 | Ga0081538_10155843 | Ga0081538_101558433 | 76 |
| 93 | 3300005985 | Ga0081539_10000430 | Ga0081539_1000043038 | 76 |
| 94 | 3300006038 | Ga0075365_10016642 | Ga0075365_100166422 | 76 |
| 95 | 3300006051 | Ga0075364_10364259 | Ga0075364_103642593 | 76 |
| 96 | 3300006175 | Ga0070712_101651777 | Ga0070712_1016517771 | 76 |
| 97 | 3300006881 | Ga0068865_100789534 | Ga0068865_1007895341 | 76 |
| 98 | 3300009147 | Ga0114129_12950228 | Ga0114129_129502282 | 76 |
| 99 | 3300009177 | Ga0105248_10399832 | Ga0105248_103998323 | 76 |
| 100 | 3300009553 | Ga0105249_10813557 | Ga0105249_108135571 | 76 |
| 101 | 3300010375 | Ga0105239_12375323 | Ga0105239_123753231 | 76 |
| 102 | 3300011119 | Ga0105246_10118122 | Ga0105246_101181223 | 76 |
| 103 | 3300013100 | Ga0157373_11009757 | Ga0157373_110097572 | 76 |
| 104 | 3300013306 | Ga0163162_10559349 | Ga0163162_105593492 | 76 |
| 105 | 3300013308 | Ga0157375_11780450 | Ga0157375_117804502 | 76 |
| 106 | 3300014325 | Ga0163163_10445581 | Ga0163163_104455812 | 76 |
| 107 | 3300020081 | Ga0206354_10715567 | Ga0206354_107155672 | 76 |
| 108 | 3300020082 | Ga0206353_10867690 | Ga0206353_108676902 | 76 |
| 109 | 3300022467 | Ga0224712_10322843 | Ga0224712_103228432 | 76 |
| 110 | 3300025900 | Ga0207710_10336243 | Ga0207710_103362432 | 76 |
| 111 | 3300025908 | Ga0207643_10365441 | Ga0207643_103654411 | 76 |
| 112 | 3300025936 | Ga0207670_10660491 | Ga0207670_106604912 | 76 |
| 113 | 3300025941 | Ga0207711_10416894 | Ga0207711_104168943 | 76 |
| 114 | 3300026078 | Ga0207702_11662068 | Ga0207702_116620681 | 76 |
| 115 | 3300026118 | Ga0207675_100810860 | Ga0207675_1008108601 | 76 |
| 116 | 3300031903 | Ga0307407_10406669 | Ga0307407_104066692 | 76 |
| 117 | 3300031995 | Ga0307409_100355991 | Ga0307409_1003559912 | 76 |
| 118 | 3300039437 | Ga0436365_0867185 | Ga0436365_0867185_984_1220 | 76 |
| 119 | 3300039437 | Ga0436365_1280913 | Ga0436365_1280913_125_361 | 76 |
| 120 | 3300039450 | Ga0436363_0022472 | Ga0436363_0022472_98_334 | 76 |
| 121 | 3300039453 | Ga0436362_0476508 | Ga0436362_0476508_2255_2491 | 76 |
| 122 | 3300039453 | Ga0436362_1011172 | Ga0436362_1011172_322_558 | 76 |
| 123 | 3300041501 | Ga0451845_0756197 | Ga0451845_0756197_355_636 | 76 |
| 124 | 3300041505 | Ga0451849_0593536 | Ga0451849_0593536_90_326 | 76 |
| 125 | 3300041512 | Ga0451853_2613687 | Ga0451853_2613687_483_719 | 76 |
| 126 | 3300044683 | Ga0466965_0138738 | Ga0466965_0138738_500_733 | 76 |
| 127 | 3300044684 | Ga0466966_0009520 | Ga0466966_0009520_5548_5784 | 76 |
| 128 | 3300044684 | Ga0466966_0066411 | Ga0466966_0066411_855_1091 | 76 |
| 129 | 3300044684 | Ga0466966_0085978 | Ga0466966_0085978_593_829 | 76 |
| 130 | 3300044693 | Ga0466961_0019882 | Ga0466961_0019882_4065_4301 | 76 |
| 131 | 3300044694 | Ga0466963_0013468 | Ga0466963_0013468_4547_4783 | 76 |
| 132 | 3300044694 | Ga0466963_0523105 | Ga0466963_0523105_374_610 | 76 |
| 133 | 3300044694 | Ga0466963_1176641 | Ga0466963_1176641_134_367 | 76 |
| 134 | 3300044706 | Ga0466964_0308747 | Ga0466964_0308747_383_619 | 76 |
| 135 | 3300044706 | Ga0466964_0466075 | Ga0466964_0466075_111_344 | 76 |
| 136 | 3300044706 | Ga0466964_0603686 | Ga0466964_0603686_141_380 | 76 |
| 137 | 3300044719 | Ga0466971_0000801 | Ga0466971_0000801_46_282 | 76 |
| 138 | 3300044719 | Ga0466971_0028658 | Ga0466971_0028658_214_450 | 76 |
| 139 | 3300044842 | Ga0466957_0010172 | Ga0466957_0010172_2011_2247 | 76 |
| 140 | 3300044842 | Ga0466957_0014414 | Ga0466957_0014414_68_304 | 76 |
| 141 | 3300044901 | Ga0466960_0218574 | Ga0466960_0218574_271_510 | 76 |
| 142 | 3300044901 | Ga0466960_0937466 | Ga0466960_0937466_25_264 | 76 |
| 143 | 3300045049 | Ga0466959_0118632 | Ga0466959_0118632_240_476 | 76 |
| 144 | 3300045049 | Ga0466959_0336706 | Ga0466959_0336706_644_880 | 76 |
| 145 | 3300045049 | Ga0466959_0737575 | Ga0466959_0737575_373_606 | 76 |
| 146 | 3300045836 | Ga0466958_0000938 | Ga0466958_0000938_11923_12159 | 76 |
| 147 | 3300045836 | Ga0466958_0276285 | Ga0466958_0276285_381_617 | 76 |
| 148 | 3300045976 | Ga0466967_0574149 | Ga0466967_0574149_50_283 | 76 |
| 149 | 3300045976 | Ga0466967_1024745 | Ga0466967_1024745_526_759 | 76 |
| 150 | 3300046615 | Ga0495656_0000217 | Ga0495656_0000217_992_1225 | 76 |
| 151 | 3300048904 | Ga0496101_0769257 | Ga0496101_0769257_296_529 | 76 |
| 152 | 3300048906 | Ga0496103_0452642 | Ga0496103_0452642_66_299 | 76 |
| 153 | 3300049572 | Ga0501036_0793883 | Ga0501036_0793883_263_496 | 76 |
| 154 | 3300049578 | Ga0501042_0277184 | Ga0501042_0277184_528_761 | 76 |
| 155 | 3300049586 | Ga0501070_0421419 | Ga0501070_0421419_763_996 | 76 |
| 156 | 3300049591 | Ga0501075_0653044 | Ga0501075_0653044_457_690 | 76 |
| 157 | 3300049592 | Ga0501076_1199353 | Ga0501076_1199353_228_461 | 76 |
| 158 | 3300049824 | Ga0501045_0243396 | Ga0501045_0243396_1056_1289 | 76 |
| 159 | 3300050491 | nmdc:mga00v17_67719_c1 | nmdc:mga00v17_67719_c1_583_819 | 76 |
| 160 | 3300050492 | nmdc:mga0yw44_24344_c1 | nmdc:mga0yw44_24344_c1_3140_3376 | 76 |
| 161 | 3300054114 | Ga0501084_0338420 | Ga0501084_0338420_178_411 | 76 |
| 162 | 3300059492 | Ga0587073_0130929 | Ga0587073_0130929_54_290 | 76 |
| 163 | 3300059643 | Ga0587072_194879 | Ga0587072_194879_64_300 | 76 |
| 164 | 3300059644 | Ga0587075_148610 | Ga0587075_148610_17_250 | 76 |
| 165 | 3300061719 | Ga0466962_0005451 | Ga0466962_0005451_3225_3461 | 76 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6e8g-assembly1.cif.gz_T | cryoem reconstruction of ist1-chmp1b copolymer filament bound to ssdna at 2.9 angstrom resolution | 0.9818 | 17 | 73 |
| 2hr5-assembly1.cif.gz_A | pf1283- rubrerythrin from pyrococcus furiosus iron bound form | 0.9789 | 16 | 71 |
| 2d5k-assembly1.cif.gz_B | crystal structure of dps from staphylococcus aureus | 0.978 | 17 | 71 |
| 5l8b-assembly2.cif.gz_Q | crystal structure of rhodospirillum rubrum rru_a0973 mutant e62a | 0.9768 | 16 | 73 |
| 5l8f-assembly1.cif.gz_C | crystal structure of rhodospirillum rubrum rru_a0973 mutant e32a, e62a, h65a. | 0.9765 | 16 | 73 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3qvdE01 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.981 | 16 | 71 | 1.20.1260.10 |
| 3qvdF01 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9807 | 16 | 71 | 1.20.1260.10 |
| 1nnqA01 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9803 | 16 | 71 | 1.20.1260.10 |
| 3qvdG01 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9798 | 16 | 71 | 1.20.1260.10 |
| 3pwfA01 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9797 | 16 | 71 | 1.20.1260.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D2JBZ2-F1-model_v4 | Ferritin-like diiron domain-containing protein | 1.003 | 17 | 75 |
|
| AF-A0A2M7SUK7-F1-model_v4 | Uncharacterized protein | 1.001 | 17 | 73 |
|
| AF-T0MSD6-F1-model_v4 | Rubrerythrin diiron-binding domain-containing protein | 0.9999 | 17 | 73 |
|
| AF-A0A2X2BWU6-F1-model_v4 | protein-glutamate methylesterase (EC 3.1.1.61) | 0.9987 | 16 | 76 |
GO:0000156
GO:0005737 GO:0006935 GO:0008984 |
| AF-A0A804PWI0-F1-model_v4 | Uncharacterized protein | 0.9973 | 17 | 73 |
GO:0007034
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar