F246161

General Info

Members Datasets Scaffolds Average Seq Length
165 120 330 143

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10168658|Ga0157374_101686583
Length 143
Sequence LSRWETTSRLDAGLNPGQVWRRAYEDAGAWPEWNAEIKRAKLDRPLGQGTSARIVFRTGLRLRFAVVEYEAGRLFTDEARLPGARMGHRHLIEAAGEGCRLTNTIYIEGPLAPLWRRLLGPAASRSLPGAQRAIVALSGEVDS

Samples

Sample ID Description Type Environment
1 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
28 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
38 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
60 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
61 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
62 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
63 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
64 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
65 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
66 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
67 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
68 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
69 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
70 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
71 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
72 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
73 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
74 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
75 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
76 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
77 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
78 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
79 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
80 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
81 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
82 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
83 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
84 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
85 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
86 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
87 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
88 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
89 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
90 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
91 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
92 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
93 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
94 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
95 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
96 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
97 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
98 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
99 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
100 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
101 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
102 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
108 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
109 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
110 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
111 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
112 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
113 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
114 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
115 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
116 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
117 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
118 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
119 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
120 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.82
Nodule 0
Rhizoplane 9.7
Rhizosphere 80.61
Stem 0
Stem Tuber 0
Unclassified 19.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157374_10168658 3300013296 Bacteria 2135
2 rootL2_10324444 3300003322 Bacteria 1275
3 Ga0070683_100019566 3300005329 Bacteria 6015
4 Ga0070677_10000004 3300005333 Bacteria 81101
5 Ga0070666_10021302 3300005335 Bacteria 4201
6 Ga0070682_100000013 3300005337 Bacteria 254641
7 Ga0070682_100000040 3300005337 Bacteria 143944
8 Ga0070689_100032789 3300005340 Unclassified 3953
9 Ga0070688_100177594 3300005365 Unclassified 1474
10 Ga0070659_100000781 3300005366 Bacteria 23119
11 Ga0070667_100040726 3300005367 Bacteria 3896
12 Ga0070713_100260630 3300005436 Unclassified 1584
13 Ga0070701_10305061 3300005438 Bacteria 980
14 Ga0070663_100217890 3300005455 Bacteria 1497
15 Ga0070663_100563895 3300005455 Bacteria 953
16 Ga0070662_100000004 3300005457 Bacteria 195534
17 Ga0070684_100087846 3300005535 Bacteria 2761
18 Ga0068853_101019005 3300005539 Unclassified 797
19 Ga0070665_100000106 3300005548 Bacteria 157315
20 Ga0070665_100089484 3300005548 Bacteria 3084
21 Ga0070665_100331750 3300005548 Bacteria 1526
22 Ga0070665_101848942 3300005548 Unclassified 610
23 Ga0068855_100696714 3300005563 Unclassified 1087
24 Ga0068854_100000083 3300005578 Bacteria 68056
25 Ga0068861_100287987 3300005719 Bacteria 1417
26 Ga0068851_10061154 3300005834 Bacteria 1930
27 Ga0068863_101995181 3300005841 Unclassified 590
28 Ga0068858_100000216 3300005842 Bacteria 62188
29 Ga0068858_100002989 3300005842 Bacteria 16955
30 Ga0068860_102325498 3300005843 Unclassified 556
31 Ga0068871_100298104 3300006358 Bacteria 1414
32 Ga0105245_10000016 3300009098 Bacteria 204372
33 Ga0105245_10006341 3300009098 Bacteria 10408
34 Ga0105247_10376586 3300009101 Unclassified 1005
35 Ga0105241_10069087 3300009174 Bacteria 2738
36 Ga0105242_10040511 3300009176 Bacteria 3754
37 Ga0105237_10859154 3300009545 Unclassified 914
38 Ga0105028_119631 3300009993 Bacteria 730
39 Ga0105239_10089788 3300010375 Bacteria 3389
40 Ga0105239_11284174 3300010375 Bacteria 844
41 Ga0157374_10004988 3300013296 Bacteria 11135
42 Ga0157372_10000150 3300013307 Bacteria 75963
43 Ga0157375_10020943 3300013308 Bacteria 5984
44 Ga0157375_10657453 3300013308 Bacteria 1204
45 Ga0163163_12010392 3300014325 Bacteria 638
46 Ga0157379_10011898 3300014968 Bacteria 7603
47 Ga0163161_10000035 3300017792 Bacteria 155979
48 Ga0206353_11185286 3300020082 Bacteria 1571
49 Ga0207656_10038353 3300025321 Bacteria 2021
50 Ga0207682_10000031 3300025893 Bacteria 57806
51 Ga0207680_10031824 3300025903 Bacteria 2992
52 Ga0207663_10329943 3300025916 Unclassified 1149
53 Ga0207687_10000018 3300025927 Bacteria 236159
54 Ga0207687_10000177 3300025927 Bacteria 42164
55 Ga0207687_10001317 3300025927 Bacteria 16982
56 Ga0207700_10951343 3300025928 Unclassified 769
57 Ga0207690_10001180 3300025932 Bacteria 16544
58 Ga0207706_10000012 3300025933 Bacteria 195475
59 Ga0207686_10000694 3300025934 Bacteria 20874
60 Ga0207661_10010418 3300025944 Bacteria 6691
61 Ga0207667_10682418 3300025949 Bacteria 1031
62 Ga0207712_10000007 3300025961 Bacteria 539589
63 Ga0207640_10000040 3300025981 Bacteria 106134
64 Ga0207658_10002835 3300025986 Bacteria 12411
65 Ga0207703_10000023 3300026035 Bacteria 222018
66 Ga0207703_10000040 3300026035 Bacteria 168191
67 Ga0207639_10552887 3300026041 Unclassified 1057
68 Ga0207702_11532544 3300026078 Unclassified 660
69 Ga0207641_12031229 3300026088 Unclassified 576
70 Ga0207675_100451432 3300026118 Unclassified 1274
71 Ga0268266_10000047 3300028379 Bacteria 310996
72 Ga0268266_10000305 3300028379 Bacteria 78003
73 Ga0451853_2784948 3300041512 Bacteria 3923
74 Ga0466965_0392204 3300044683 Bacteria 766
75 Ga0466963_0166480 3300044694 Unclassified 1535
76 Ga0466963_0552994 3300044694 Unclassified 813
77 Ga0466967_0000003 3300045976 Bacteria 169144
78 Ga0466967_0094422 3300045976 Unclassified 2724
79 Ga0495629_0010655 3300046459 Bacteria 6688
80 Ga0495641_0000044 3300046461 Bacteria 77415
81 Ga0495641_0106521 3300046461 Bacteria 1251
82 Ga0495608_0000146 3300046511 Bacteria 51037
83 Ga0495608_0001071 3300046511 Bacteria 19292
84 Ga0495608_0018554 3300046511 Bacteria 4796
85 Ga0495618_0000594 3300046514 Bacteria 25841
86 Ga0495620_0000144 3300046515 Bacteria 58204
87 Ga0495630_0020497 3300046517 Bacteria 4875
88 Ga0495630_0537293 3300046517 Bacteria 896
89 Ga0495630_0593594 3300046517 Unclassified 849
90 Ga0495652_0561926 3300046529 Unclassified 783
91 Ga0495587_0479985 3300046536 Unclassified 688
92 Ga0495656_0013417 3300046615 Unclassified 3048
93 Ga0495634_0004922 3300046642 Bacteria 10335
94 Ga0495657_0000003 3300046675 Bacteria 279680
95 Ga0495657_0010862 3300046675 Bacteria 6835
96 Ga0495669_0000603 3300046684 Bacteria 15735
97 Ga0495613_0000027 3300046689 Bacteria 146674
98 Ga0495613_0000203 3300046689 Bacteria 58232
99 Ga0495613_0158329 3300046689 Unclassified 1612
100 Ga0495624_0000007 3300046690 Bacteria 146202
101 Ga0495624_0626092 3300046690 Unclassified 641
102 Ga0495649_0000554 3300046694 Bacteria 31688
103 Ga0495600_0000787 3300046809 Bacteria 16744
104 Ga0495600_0001001 3300046809 Bacteria 15248
105 Ga0495604_0000058 3300047317 Bacteria 96955
106 Ga0495604_0000940 3300047317 Bacteria 24246
107 Ga0495672_0088173 3300047320 Unclassified 1711
108 Ga0495676_0000299 3300047321 Bacteria 40098
109 Ga0495680_0003349 3300047322 Bacteria 15838
110 Ga0495675_0000002 3300047444 Bacteria 216469
111 Ga0495602_0000331 3300048088 Bacteria 43719
112 Ga0495602_0713682 3300048088 Unclassified 679
113 Ga0496100_0000002 3300048903 Bacteria 489057
114 Ga0496101_0000001 3300048904 Bacteria 489057
115 Ga0496104_0000002 3300048907 Bacteria 686017
116 Ga0496104_0000009 3300048907 Bacteria 488055
117 Ga0496104_0050925 3300048907 Bacteria 3907
118 Ga0496105_0000001 3300048908 Bacteria 1328178
119 Ga0496105_0000027 3300048908 Bacteria 148197
120 Ga0496105_0009286 3300048908 Bacteria 7687
121 Ga0496105_0018782 3300048908 Bacteria 5566
122 Ga0496106_0000061 3300048909 Bacteria 86524
123 Ga0496107_0000013 3300048910 Bacteria 178284
124 Ga0496108_0000001 3300048911 Bacteria 919044
125 Ga0496109_0000003 3300048912 Bacteria 420862
126 Ga0496110_0000023 3300048913 Bacteria 75802
127 Ga0496111_0000181 3300048914 Bacteria 28684
128 Ga0496114_0036910 3300048917 Bacteria 4040
129 Ga0496118_0056810 3300048921 Bacteria 2939
130 Ga0496119_0049447 3300048922 Bacteria 2599
131 Ga0496120_0002441 3300048923 Bacteria 18813
132 Ga0496120_0479292 3300048923 Archaea 537
133 Ga0496121_0006771 3300048924 Bacteria 14057
134 Ga0496121_0039580 3300048924 Bacteria 4150
135 Ga0496121_0092598 3300048924 Bacteria 2356
136 Ga0496124_0036524 3300048927 Bacteria 4284
137 Ga0496124_0508311 3300048927 Unclassified 806
138 Ga0496125_0076419 3300048928 Bacteria 2586
139 Ga0496125_0093469 3300048928 Bacteria 2244
140 Ga0501031_0714735 3300049568 Bacteria 643
141 Ga0501034_0019042 3300049571 Bacteria 7032
142 Ga0501036_0387487 3300049572 Bacteria 1166
143 Ga0501040_0809725 3300049576 Bacteria 678
144 Ga0501042_0038053 3300049578 Bacteria 3416
145 Ga0501070_0715369 3300049586 Bacteria 791
146 Ga0501070_0991125 3300049586 Bacteria 652
147 Ga0501075_0165200 3300049591 Bacteria 1689
148 Ga0501076_0516174 3300049592 Bacteria 985
149 Ga0501076_1006969 3300049592 Unclassified 686
150 Ga0501077_0342989 3300049593 Bacteria 953
151 Ga0501044_0099581 3300049823 Bacteria 2925
152 nmdc:mga0n895_816717_c1 3300050512 Unclassified 922
153 Ga0495601_0000017 3300053077 Bacteria 204209
154 Ga0495601_0000326 3300053077 Bacteria 25282
155 Ga0495612_0000915 3300053078 Bacteria 12062
156 Ga0495595_0000068 3300053084 Bacteria 51063
157 Ga0495595_0000172 3300053084 Bacteria 25608
158 Ga0495595_0004453 3300053084 Bacteria 5639
159 Ga0495619_0000018 3300053085 Bacteria 209943
160 Ga0495619_0000021 3300053085 Bacteria 187095
161 Ga0495619_0000153 3300053085 Bacteria 51013
162 Ga0500566_0001679 3300053094 Bacteria 12979
163 Ga0500595_074875 3300053119 Unclassified 999
164 Ga0500614_000324 3300053123 Bacteria 12378
165 Ga0501082_1610311 3300060353 Unclassified 567
166 Ga0157374_10168658
167 rootL2_10324444
168 Ga0070683_100019566
169 Ga0070677_10000004
170 Ga0070666_10021302
171 Ga0070682_100000013
172 Ga0070682_100000040
173 Ga0070689_100032789
174 Ga0070688_100177594
175 Ga0070659_100000781
176 Ga0070667_100040726
177 Ga0070713_100260630
178 Ga0070701_10305061
179 Ga0070663_100217890
180 Ga0070663_100563895
181 Ga0070662_100000004
182 Ga0070684_100087846
183 Ga0068853_101019005
184 Ga0070665_100000106
185 Ga0070665_100089484
186 Ga0070665_100331750
187 Ga0070665_101848942
188 Ga0068855_100696714
189 Ga0068854_100000083
190 Ga0068861_100287987
191 Ga0068851_10061154
192 Ga0068863_101995181
193 Ga0068858_100000216
194 Ga0068858_100002989
195 Ga0068860_102325498
196 Ga0068871_100298104
197 Ga0105245_10000016
198 Ga0105245_10006341
199 Ga0105247_10376586
200 Ga0105241_10069087
201 Ga0105242_10040511
202 Ga0105237_10859154
203 Ga0105028_119631
204 Ga0105239_10089788
205 Ga0105239_11284174
206 Ga0157374_10004988
207 Ga0157372_10000150
208 Ga0157375_10020943
209 Ga0157375_10657453
210 Ga0163163_12010392
211 Ga0157379_10011898
212 Ga0163161_10000035
213 Ga0206353_11185286
214 Ga0207656_10038353
215 Ga0207682_10000031
216 Ga0207680_10031824
217 Ga0207663_10329943
218 Ga0207687_10000018
219 Ga0207687_10000177
220 Ga0207687_10001317
221 Ga0207700_10951343
222 Ga0207690_10001180
223 Ga0207706_10000012
224 Ga0207686_10000694
225 Ga0207661_10010418
226 Ga0207667_10682418
227 Ga0207712_10000007
228 Ga0207640_10000040
229 Ga0207658_10002835
230 Ga0207703_10000023
231 Ga0207703_10000040
232 Ga0207639_10552887
233 Ga0207702_11532544
234 Ga0207641_12031229
235 Ga0207675_100451432
236 Ga0268266_10000047
237 Ga0268266_10000305
238 Ga0451853_2784948
239 Ga0466965_0392204
240 Ga0466963_0166480
241 Ga0466963_0552994
242 Ga0466967_0000003
243 Ga0466967_0094422
244 Ga0495629_0010655
245 Ga0495641_0000044
246 Ga0495641_0106521
247 Ga0495608_0000146
248 Ga0495608_0001071
249 Ga0495608_0018554
250 Ga0495618_0000594
251 Ga0495620_0000144
252 Ga0495630_0020497
253 Ga0495630_0537293
254 Ga0495630_0593594
255 Ga0495652_0561926
256 Ga0495587_0479985
257 Ga0495656_0013417
258 Ga0495634_0004922
259 Ga0495657_0000003
260 Ga0495657_0010862
261 Ga0495669_0000603
262 Ga0495613_0000027
263 Ga0495613_0000203
264 Ga0495613_0158329
265 Ga0495624_0000007
266 Ga0495624_0626092
267 Ga0495649_0000554
268 Ga0495600_0000787
269 Ga0495600_0001001
270 Ga0495604_0000058
271 Ga0495604_0000940
272 Ga0495672_0088173
273 Ga0495676_0000299
274 Ga0495680_0003349
275 Ga0495675_0000002
276 Ga0495602_0000331
277 Ga0495602_0713682
278 Ga0496100_0000002
279 Ga0496101_0000001
280 Ga0496104_0000002
281 Ga0496104_0000009
282 Ga0496104_0050925
283 Ga0496105_0000001
284 Ga0496105_0000027
285 Ga0496105_0009286
286 Ga0496105_0018782
287 Ga0496106_0000061
288 Ga0496107_0000013
289 Ga0496108_0000001
290 Ga0496109_0000003
291 Ga0496110_0000023
292 Ga0496111_0000181
293 Ga0496114_0036910
294 Ga0496118_0056810
295 Ga0496119_0049447
296 Ga0496120_0002441
297 Ga0496120_0479292
298 Ga0496121_0006771
299 Ga0496121_0039580
300 Ga0496121_0092598
301 Ga0496124_0036524
302 Ga0496124_0508311
303 Ga0496125_0076419
304 Ga0496125_0093469
305 Ga0501031_0714735
306 Ga0501034_0019042
307 Ga0501036_0387487
308 Ga0501040_0809725
309 Ga0501042_0038053
310 Ga0501070_0715369
311 Ga0501070_0991125
312 Ga0501075_0165200
313 Ga0501076_0516174
314 Ga0501076_1006969
315 Ga0501077_0342989
316 Ga0501044_0099581
317 nmdc:mga0n895_816717_c1
318 Ga0495601_0000017
319 Ga0495601_0000326
320 Ga0495612_0000915
321 Ga0495595_0000068
322 Ga0495595_0000172
323 Ga0495595_0004453
324 Ga0495619_0000018
325 Ga0495619_0000021
326 Ga0495619_0000153
327 Ga0500566_0001679
328 Ga0500595_074875
329 Ga0500614_000324
330 Ga0501082_1610311

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

3

136

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4r7k-assembly1.cif.gz_D 1.88 angstrom resolution crystal structure of hypothetical protein jhp0584 from helicobacter pylori. 0.8161 4 139
2res-assembly1.cif.gz_A tetracenomycin aro/cyc mutant r69a 0.8109 2 141
3ijt-assembly1.cif.gz_A structural characterization of smu.440, a hypothetical protein from streptococcus mutans 0.8037 1 140
3q63-assembly2.cif.gz_D x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. 0.7979 4 142
2res-assembly1.cif.gz_A tetracenomycin aro/cyc mutant r69a 0.7957 2 141
ID Description Score Start End Superfamily
af_A0A1D8PLT3_1_151_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8613 4 141 3.30.530.20
3ijtB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8401 3 141 3.30.530.20
af_I6Y1P2_6_156_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8358 6 142 3.30.530.20
af_O07748_5_153_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8337 2 142 3.30.530.20
af_I6X666_8_157_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8336 4 141 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A7W1MXS0-F1-model_v4 SRPBCC family protein 0.9724 2 140
AF-A0A2W6ASA2-F1-model_v4 Polyketide cyclase 0.9707 4 140
AF-A0A7V5DD05-F1-model_v4 Polyketide cyclase 0.968 5 142
AF-A0A2G6HLE5-F1-model_v4 Polyketide cyclase 0.9675 3 142
AF-A0A852VH88-F1-model_v4 SRPBCC family protein 0.967 2 135

Map