F246120

General Info

Members Datasets Scaffolds Average Seq Length
165 53 330 100

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10358313|Ga0105239_103583132
Length 105
Sequence MAAMDDDQIISALERFPHWRREGNQILRPVEAPSFLEGIELVGVVARAAEAANHHPDIDIRWRTVTFTLSTHSEGGITEKDFALAEQIDEAVNRMVAREIDDPVE

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
3 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
4 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
5 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
6 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
13 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
14 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
15 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
22 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
23 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
24 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
25 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
26 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
27 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
28 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
29 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
30 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
31 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
32 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
33 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
34 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
35 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
36 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
37 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
38 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
39 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
40 3300031592 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
41 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
42 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
43 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
44 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
45 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
46 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
47 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
48 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
49 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
50 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
51 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
52 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
53 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.61
Nodule 0
Rhizoplane 0
Rhizosphere 98.79
Stem 0
Stem Tuber 0
Unclassified 18.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10358313 3300010375 Bacteria 1647
2 Ga0070660_100017529 3300005339 Bacteria 5223
3 Ga0070660_100566695 3300005339 Bacteria 948
4 Ga0070659_100756454 3300005366 Bacteria 843
5 Ga0070711_100010687 3300005439 Bacteria 5688
6 Ga0070663_101082854 3300005455 Bacteria 700
7 Ga0070662_100028116 3300005457 Bacteria 3911
8 Ga0070681_10012712 3300005458 Bacteria 8355
9 Ga0070679_100137619 3300005530 Bacteria 2423
10 Ga0068855_100257225 3300005563 Bacteria 1946
11 Ga0070664_100008662 3300005564 Bacteria 8233
12 Ga0068856_102196552 3300005614 Bacteria 561
13 Ga0068863_100442200 3300005841 Bacteria 1275
14 Ga0207705_10805920 3300025909 Bacteria 729
15 Ga0207707_10013813 3300025912 Bacteria 7042
16 Ga0207663_10007395 3300025916 Bacteria 5694
17 Ga0207657_10159195 3300025919 Bacteria 1835
18 Ga0207657_10358916 3300025919 Bacteria 1149
19 Ga0207649_10299611 3300025920 Bacteria 1175
20 Ga0207652_10111298 3300025921 Bacteria 2428
21 Ga0207706_10020829 3300025933 Bacteria 5890
22 Ga0207679_10023368 3300025945 Bacteria 4226
23 Ga0265337_1000811 3300028556 Bacteria 16469
24 Ga0265337_1001277 3300028556 Bacteria 12644
25 Ga0265337_1009875 3300028556 Bacteria 3375
26 Ga0265337_1012049 3300028556 Bacteria 2954
27 Ga0265337_1013290 3300028556 Bacteria 2768
28 Ga0265337_1024264 3300028556 Bacteria 1857
29 Ga0265337_1027712 3300028556 Bacteria 1705
30 Ga0265337_1101713 3300028556 Unclassified 782
31 Ga0265326_10038208 3300028558 Unclassified 1364
32 Ga0265319_1000007 3300028563 Bacteria 217194
33 Ga0265319_1009134 3300028563 Bacteria 4253
34 Ga0265319_1011042 3300028563 Bacteria 3730
35 Ga0265319_1013062 3300028563 Unclassified 3323
36 Ga0265319_1165794 3300028563 Bacteria 682
37 Ga0265334_10012603 3300028573 Bacteria 3550
38 Ga0265334_10023717 3300028573 Unclassified 2493
39 Ga0265334_10031300 3300028573 Bacteria 2127
40 Ga0265334_10146869 3300028573 Unclassified 833
41 Ga0265318_10047382 3300028577 Bacteria 1621
42 Ga0265318_10169671 3300028577 Bacteria 799
43 Ga0265318_10370304 3300028577 Unclassified 523
44 Ga0265323_10084291 3300028653 Bacteria 1070
45 Ga0265323_10095396 3300028653 Unclassified 989
46 Ga0265323_10128871 3300028653 Unclassified 820
47 Ga0265322_10108598 3300028654 Bacteria 789
48 Ga0265322_10214719 3300028654 Unclassified 551
49 Ga0265336_10014259 3300028666 Bacteria 2637
50 Ga0265336_10018916 3300028666 Bacteria 2226
51 Ga0265336_10042834 3300028666 Bacteria 1381
52 Ga0265338_10002894 3300028800 Bacteria 25006
53 Ga0265338_10003436 3300028800 Bacteria 22323
54 Ga0265338_10003759 3300028800 Bacteria 21088
55 Ga0265338_10004397 3300028800 Bacteria 19064
56 Ga0265338_10004532 3300028800 Bacteria 18717
57 Ga0265338_10004814 3300028800 Bacteria 18043
58 Ga0265338_10004967 3300028800 Bacteria 17611
59 Ga0265338_10005262 3300028800 Bacteria 16954
60 Ga0265338_10006021 3300028800 Bacteria 15578
61 Ga0265338_10006625 3300028800 Bacteria 14668
62 Ga0265338_10010930 3300028800 Bacteria 10552
63 Ga0265338_10016331 3300028800 Bacteria 8086
64 Ga0265338_10024872 3300028800 Bacteria 6101
65 Ga0265338_10043962 3300028800 Bacteria 4132
66 Ga0265338_10050886 3300028800 Unclassified 3738
67 Ga0265338_10058043 3300028800 Unclassified 3419
68 Ga0265338_10059381 3300028800 Bacteria 3369
69 Ga0265338_10060839 3300028800 Bacteria 3313
70 Ga0265338_10065419 3300028800 Bacteria 3154
71 Ga0265338_10086868 3300028800 Bacteria 2600
72 Ga0265338_10092316 3300028800 Bacteria 2497
73 Ga0265338_10097283 3300028800 Bacteria 2412
74 Ga0265338_10120822 3300028800 Bacteria 2088
75 Ga0265338_10208690 3300028800 Bacteria 1468
76 Ga0265338_10260489 3300028800 Bacteria 1275
77 Ga0265338_10321247 3300028800 Bacteria 1120
78 Ga0265338_10501827 3300028800 Bacteria 854
79 Ga0265338_10523650 3300028800 Bacteria 832
80 Ga0265338_10548889 3300028800 Unclassified 809
81 Ga0265338_10606084 3300028800 Unclassified 762
82 Ga0265338_10667876 3300028800 Unclassified 719
83 Ga0265338_10742276 3300028800 Bacteria 675
84 Ga0265338_10743284 3300028800 Unclassified 675
85 Ga0265324_10006746 3300029957 Unclassified 4741
86 Ga0265324_10009597 3300029957 Bacteria 3770
87 Ga0265324_10023248 3300029957 Unclassified 2208
88 Ga0265324_10034874 3300029957 Unclassified 1752
89 Ga0265324_10037538 3300029957 Bacteria 1683
90 Ga0265324_10044342 3300029957 Bacteria 1533
91 Ga0265324_10052825 3300029957 Bacteria 1396
92 Ga0265324_10065922 3300029957 Unclassified 1236
93 Ga0265324_10078747 3300029957 Bacteria 1122
94 Ga0265324_10099534 3300029957 Bacteria 988
95 Ga0265330_10219493 3300031235 Bacteria 803
96 Ga0265332_10068599 3300031238 Bacteria 1511
97 Ga0265332_10120002 3300031238 Bacteria 1105
98 Ga0265320_10000269 3300031240 Bacteria 43090
99 Ga0265320_10011518 3300031240 Bacteria 5200
100 Ga0265320_10025677 3300031240 Bacteria 3094
101 Ga0265320_10036893 3300031240 Unclassified 2467
102 Ga0265320_10053087 3300031240 Bacteria 1960
103 Ga0265320_10119164 3300031240 Bacteria 1205
104 Ga0265320_10267201 3300031240 Bacteria 758
105 Ga0265320_10306336 3300031240 Bacteria 702
106 Ga0265320_10359155 3300031240 Bacteria 643
107 Ga0265325_10007217 3300031241 Bacteria 6681
108 Ga0265325_10008420 3300031241 Bacteria 6088
109 Ga0265325_10024417 3300031241 Bacteria 3290
110 Ga0265329_10202275 3300031242 Bacteria 654
111 Ga0265340_10015225 3300031247 Bacteria 4000
112 Ga0265340_10019241 3300031247 Bacteria 3516
113 Ga0265340_10031595 3300031247 Bacteria 2647
114 Ga0265340_10055061 3300031247 Unclassified 1917
115 Ga0265340_10193056 3300031247 Bacteria 918
116 Ga0265340_10519641 3300031247 Bacteria 524
117 Ga0265339_10040278 3300031249 Unclassified 2597
118 Ga0265339_10354247 3300031249 Bacteria 691
119 Ga0265339_10538137 3300031249 Unclassified 538
120 Ga0265339_10586260 3300031249 Bacteria 512
121 Ga0265327_10001819 3300031251 Bacteria 24953
122 Ga0265327_10008206 3300031251 Bacteria 7830
123 Ga0265327_10017929 3300031251 Bacteria 4415
124 Ga0265327_10061727 3300031251 Bacteria 1910
125 Ga0265327_10133863 3300031251 Bacteria 1164
126 Ga0265327_10265005 3300031251 Bacteria 762
127 Ga0265316_10001644 3300031344 Bacteria 23838
128 Ga0265316_10018273 3300031344 Bacteria 6029
129 Ga0265316_10019209 3300031344 Bacteria 5852
130 Ga0265316_10047953 3300031344 Bacteria 3376
131 Ga0265316_10234222 3300031344 Bacteria 1351
132 Ga0265316_10234334 3300031344 Bacteria 1351
133 Ga0265316_10452015 3300031344 Unclassified 921
134 Ga0265316_10613292 3300031344 Unclassified 771
135 Ga0265316_10708126 3300031344 Bacteria 709
136 Ga0265316_10727556 3300031344 Bacteria 698
137 Ga0265316_10797077 3300031344 Bacteria 663
138 Ga0310117_115117 3300031592 Bacteria 798
139 Ga0265313_10002233 3300031595 Bacteria 17042
140 Ga0265313_10012582 3300031595 Bacteria 5150
141 Ga0265313_10029268 3300031595 Bacteria 2851
142 Ga0265313_10049170 3300031595 Unclassified 2030
143 Ga0265314_10009349 3300031711 Bacteria 8294
144 Ga0265314_10045496 3300031711 Bacteria 3103
145 Ga0265314_10149380 3300031711 Bacteria 1435
146 Ga0265314_10216900 3300031711 Unclassified 1119
147 Ga0265342_10041488 3300031712 Bacteria 2786
148 Ga0265342_10047375 3300031712 Unclassified 2579
149 Ga0265342_10131741 3300031712 Bacteria 1400
150 Ga0265342_10143797 3300031712 Bacteria 1329
151 Ga0265342_10163361 3300031712 Bacteria 1230
152 Ga0265342_10207543 3300031712 Bacteria 1061
153 Ga0265342_10248558 3300031712 Bacteria 950
154 Ga0265342_10337049 3300031712 Unclassified 788
155 Ga0307413_10891185 3300031824 Bacteria 755
156 Ga0316583_10009086 3300032133 Bacteria 3585
157 Ga0395899_0293750 3300037312 Bacteria 1102
158 Ga0395899_0727454 3300037312 Bacteria 620
159 Ga0395900_0269521 3300037418 Bacteria 1698
160 Ga0395901_0287516 3300038443 Bacteria 1707
161 Ga0439435_0067584 3300042436 Bacteria 1053
162 Ga0466972_0135744 3300044658 Bacteria 1158
163 Ga0466965_0093764 3300044683 Bacteria 1529
164 Ga0466967_2492691 3300045976 Bacteria 512
165 Ga0500636_0108861 3300053177 Unclassified 1568
166 Ga0105239_10358313
167 Ga0070660_100017529
168 Ga0070660_100566695
169 Ga0070659_100756454
170 Ga0070711_100010687
171 Ga0070663_101082854
172 Ga0070662_100028116
173 Ga0070681_10012712
174 Ga0070679_100137619
175 Ga0068855_100257225
176 Ga0070664_100008662
177 Ga0068856_102196552
178 Ga0068863_100442200
179 Ga0207705_10805920
180 Ga0207707_10013813
181 Ga0207663_10007395
182 Ga0207657_10159195
183 Ga0207657_10358916
184 Ga0207649_10299611
185 Ga0207652_10111298
186 Ga0207706_10020829
187 Ga0207679_10023368
188 Ga0265337_1000811
189 Ga0265337_1001277
190 Ga0265337_1009875
191 Ga0265337_1012049
192 Ga0265337_1013290
193 Ga0265337_1024264
194 Ga0265337_1027712
195 Ga0265337_1101713
196 Ga0265326_10038208
197 Ga0265319_1000007
198 Ga0265319_1009134
199 Ga0265319_1011042
200 Ga0265319_1013062
201 Ga0265319_1165794
202 Ga0265334_10012603
203 Ga0265334_10023717
204 Ga0265334_10031300
205 Ga0265334_10146869
206 Ga0265318_10047382
207 Ga0265318_10169671
208 Ga0265318_10370304
209 Ga0265323_10084291
210 Ga0265323_10095396
211 Ga0265323_10128871
212 Ga0265322_10108598
213 Ga0265322_10214719
214 Ga0265336_10014259
215 Ga0265336_10018916
216 Ga0265336_10042834
217 Ga0265338_10002894
218 Ga0265338_10003436
219 Ga0265338_10003759
220 Ga0265338_10004397
221 Ga0265338_10004532
222 Ga0265338_10004814
223 Ga0265338_10004967
224 Ga0265338_10005262
225 Ga0265338_10006021
226 Ga0265338_10006625
227 Ga0265338_10010930
228 Ga0265338_10016331
229 Ga0265338_10024872
230 Ga0265338_10043962
231 Ga0265338_10050886
232 Ga0265338_10058043
233 Ga0265338_10059381
234 Ga0265338_10060839
235 Ga0265338_10065419
236 Ga0265338_10086868
237 Ga0265338_10092316
238 Ga0265338_10097283
239 Ga0265338_10120822
240 Ga0265338_10208690
241 Ga0265338_10260489
242 Ga0265338_10321247
243 Ga0265338_10501827
244 Ga0265338_10523650
245 Ga0265338_10548889
246 Ga0265338_10606084
247 Ga0265338_10667876
248 Ga0265338_10742276
249 Ga0265338_10743284
250 Ga0265324_10006746
251 Ga0265324_10009597
252 Ga0265324_10023248
253 Ga0265324_10034874
254 Ga0265324_10037538
255 Ga0265324_10044342
256 Ga0265324_10052825
257 Ga0265324_10065922
258 Ga0265324_10078747
259 Ga0265324_10099534
260 Ga0265330_10219493
261 Ga0265332_10068599
262 Ga0265332_10120002
263 Ga0265320_10000269
264 Ga0265320_10011518
265 Ga0265320_10025677
266 Ga0265320_10036893
267 Ga0265320_10053087
268 Ga0265320_10119164
269 Ga0265320_10267201
270 Ga0265320_10306336
271 Ga0265320_10359155
272 Ga0265325_10007217
273 Ga0265325_10008420
274 Ga0265325_10024417
275 Ga0265329_10202275
276 Ga0265340_10015225
277 Ga0265340_10019241
278 Ga0265340_10031595
279 Ga0265340_10055061
280 Ga0265340_10193056
281 Ga0265340_10519641
282 Ga0265339_10040278
283 Ga0265339_10354247
284 Ga0265339_10538137
285 Ga0265339_10586260
286 Ga0265327_10001819
287 Ga0265327_10008206
288 Ga0265327_10017929
289 Ga0265327_10061727
290 Ga0265327_10133863
291 Ga0265327_10265005
292 Ga0265316_10001644
293 Ga0265316_10018273
294 Ga0265316_10019209
295 Ga0265316_10047953
296 Ga0265316_10234222
297 Ga0265316_10234334
298 Ga0265316_10452015
299 Ga0265316_10613292
300 Ga0265316_10708126
301 Ga0265316_10727556
302 Ga0265316_10797077
303 Ga0310117_115117
304 Ga0265313_10002233
305 Ga0265313_10012582
306 Ga0265313_10029268
307 Ga0265313_10049170
308 Ga0265314_10009349
309 Ga0265314_10045496
310 Ga0265314_10149380
311 Ga0265314_10216900
312 Ga0265342_10041488
313 Ga0265342_10047375
314 Ga0265342_10131741
315 Ga0265342_10143797
316 Ga0265342_10163361
317 Ga0265342_10207543
318 Ga0265342_10248558
319 Ga0265342_10337049
320 Ga0307413_10891185
321 Ga0316583_10009086
322 Ga0395899_0293750
323 Ga0395899_0727454
324 Ga0395900_0269521
325 Ga0395901_0287516
326 Ga0439435_0067584
327 Ga0466972_0135744
328 Ga0466965_0093764
329 Ga0466967_2492691
330 Ga0500636_0108861

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01329

Pterin_4a

Pterin 4 alpha carbinolamine dehydratase

2

91

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ebb-assembly1.cif.gz_A-2 crystal structure of pterin-4-alpha-carbinolamine dehydratase (pterin carbinolamine dehydratase) from geobacillus kaustophilus hta426 0.9682 2 91
3jst-assembly2.cif.gz_B crystal structure of transcriptional coactivator/pterin dehydratase from brucella melitensis 0.9644 2 93
1usm-assembly1.cif.gz_A-2 dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant 0.945 19 91
3jst-assembly2.cif.gz_B crystal structure of transcriptional coactivator/pterin dehydratase from brucella melitensis 0.9348 2 93
3hxa-assembly1.cif.gz_D crystal structure of dcoh1thr51ser 0.9306 3 92
ID Description Score Start End Superfamily
af_Q4CYK3_54_151_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9789 1 91 3.30.1360.20
af_P9WI93_1_93_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9711 1 91 3.30.1360.20
2ebbA00 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9682 2 91 3.30.1360.20
af_Q6MX13_31_126_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9454 3 97 3.30.1360.20
af_P9WI93_1_93_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9408 1 91 3.30.1360.20
ID Description Score Start End GO Terms
AF-A0A3D5AM23-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96) 0.9987 24 91 GO:0006729
GO:0008124
AF-A0A2E8P6T0-F1-model_v4 4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96) 0.9937 3 91 GO:0006729
GO:0008124
AF-A0A1Q7M0V3-F1-model_v4 4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96) 0.993 27 97 GO:0006729
GO:0008124
AF-A0A523EWV6-F1-model_v4 deleted 0.9918 1 91
AF-A0A800JYK8-F1-model_v4 4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96) 0.991 2 93 GO:0006729
GO:0008124

Map