F246115

General Info

Members Datasets Scaffolds Average Seq Length
165 143 147 179

Family's Representative Sequence

Representative Sequence 3300010159|Ga0099796_10147748|Ga0099796_101477482
Length 216
Sequence MTDYRRNFLAGGSFFFTVNLAERHLRLLTDHIDKLRAAFRETRRRHPFTIDAMVVLPDHLHTIWTLPEGDADFATRWRLIKSAFSRSLATGERISKSRAAKGERGIWQRRFWEHTVRDDHDFARHFDYIHINPVKHRLVARVSDWPCSSFHRMVKLSVYPRIGQAMARMRVRILESGHKRLTARRWVSQALNPSYGLTALRSIRGTLFSLRTKATP

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
3 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
4 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
5 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
6 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
7 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
8 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
9 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
10 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
11 2904699407
12 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
13 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
14 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
15 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
16 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
17 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
18 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
45 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
80 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
81 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
82 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
83 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
84 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
85 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
91 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
92 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
93 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
94 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
95 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
96 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
97 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
98 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
99 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
100 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
101 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
102 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
103 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
104 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
105 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
106 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
107 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
108 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
109 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
110 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
111 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
112 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
114 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
115 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
116 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
119 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
120 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
121 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
122 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
123 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
124 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
125 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
126 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
127 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
128 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
129 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
130 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
131 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
132 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
133 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
134 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
135 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
136 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
137 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
138 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
139 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
140 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
141 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
142 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
143 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.63
Metatranscriptomes 0
Isolates 10.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.97
Nodule 8.48
Rhizoplane 2.42
Rhizosphere 65.45
Stem 0
Stem Tuber 0
Unclassified 6.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_4859628 2162886012 Bacteria 819
2 Ga0065715_10164891 3300005293 Bacteria 1595
3 Ga0065715_10350269 3300005293 Bacteria 906
4 Ga0070670_100646197 3300005331 Bacteria 949
5 Ga0070666_10680424 3300005335 Bacteria 754
6 Ga0070668_100327861 3300005347 Bacteria 1290
7 Ga0070668_100369919 3300005347 Bacteria 1217
8 Ga0070674_100498674 3300005356 Bacteria 1014
9 Ga0070688_100458970 3300005365 Bacteria 954
10 Ga0070667_100225161 3300005367 Bacteria 1670
11 Ga0070667_100695286 3300005367 Bacteria 941
12 Ga0070686_100191506 3300005544 Bacteria 1460
13 Ga0070686_100565091 3300005544 Bacteria 892
14 Ga0070664_101224786 3300005564 Bacteria 708
15 Ga0068859_101117917 3300005617 Bacteria 867
16 Ga0068858_100179677 3300005842 Bacteria 1997
17 Ga0068860_100461037 3300005843 Bacteria 1264
18 Ga0068862_100135923 3300005844 Bacteria 2178
19 Ga0081540_1151328 3300005983 Bacteria 915
20 Ga0081539_10019880 3300005985 Bacteria 4573
21 Ga0070717_10901379 3300006028 Bacteria 805
22 Ga0075365_10286895 3300006038 Bacteria 1158
23 Ga0075365_10431560 3300006038 Bacteria 930
24 Ga0075365_10645046 3300006038 Bacteria 748
25 Ga0075363_100092881 3300006048 Bacteria 1662
26 Ga0075363_100290204 3300006048 Bacteria 948
27 Ga0075367_10182276 3300006178 Bacteria 1309
28 Ga0075428_100237303 3300006844 Bacteria 1968
29 Ga0075431_100401928 3300006847 Bacteria 1371
30 Ga0075433_10099515 3300006852 Bacteria 2574
31 Ga0075434_101669093 3300006871 Bacteria 645
32 Ga0075436_100163338 3300006914 Bacteria 1570
33 Ga0097620_101117963 3300006931 Bacteria 867
34 Ga0099794_10120288 3300007265 Bacteria 1321
35 Ga0099795_10033238 3300007788 Bacteria 1790
36 Ga0099795_10038444 3300007788 Bacteria 1689
37 Ga0111539_10131590 3300009094 Bacteria 2929
38 Ga0111539_10160821 3300009094 Bacteria 2626
39 Ga0105247_10197616 3300009101 Bacteria 1349
40 Ga0105243_10342237 3300009148 Bacteria 1370
41 Ga0105237_10217289 3300009545 Bacteria 1911
42 Ga0105249_11373440 3300009553 Bacteria 778
43 Ga0099796_10007915 3300010159 Bacteria 2804
44 Ga0099796_10147748 3300010159 Bacteria 923
45 Ga0105246_10800605 3300011119 Bacteria 836
46 Ga0105246_11334232 3300011119 Bacteria 666
47 Ga0163162_11335730 3300013306 Bacteria 815
48 Ga0163163_10954962 3300014325 Bacteria 920
49 Ga0157380_11000262 3300014326 Bacteria 869
50 Ga0157379_10399251 3300014968 Bacteria 1264
51 Ga0209758_1018411 3300025297 Bacteria 3424
52 Ga0207710_10123658 3300025900 Bacteria 1237
53 Ga0207688_10337843 3300025901 Bacteria 926
54 Ga0207680_10695716 3300025903 Bacteria 728
55 Ga0207693_10776743 3300025915 Bacteria 739
56 Ga0207660_11050034 3300025917 Bacteria 664
57 Ga0207650_10968584 3300025925 Bacteria 723
58 Ga0207700_11052953 3300025928 Bacteria 728
59 Ga0207709_10740616 3300025935 Bacteria 789
60 Ga0207669_10616798 3300025937 Bacteria 883
61 Ga0207711_10457878 3300025941 Bacteria 1188
62 Ga0207689_10354531 3300025942 Bacteria 1220
63 Ga0207712_10533658 3300025961 Bacteria 1007
64 Ga0207668_10052248 3300025972 Bacteria 2826
65 Ga0207658_10245724 3300025986 Bacteria 1518
66 Ga0207683_10920772 3300026121 Bacteria 812
67 Ga0209179_1000866 3300027512 Bacteria 3368
68 Ga0209588_1031067 3300027671 Bacteria 1708
69 Ga0207428_10230969 3300027907 Bacteria 1384
70 Ga0268266_10012197 3300028379 Bacteria 7437
71 Ga0268265_10082570 3300028380 Bacteria 2541
72 Ga0268264_10283897 3300028381 Bacteria 1552
73 Ga0265340_10145582 3300031247 Bacteria 1082
74 Ga0307516_10313678 3300031730 Bacteria 1241
75 Ga0307510_10080319 3300033180 Bacteria 3172
76 Ga0373960_0220977 3300035121 Bacteria 678
77 Ga0373955_0434954 3300035172 Bacteria 799
78 Ga0373931_0141609 3300035691 Bacteria 1393
79 Ga0373935_0430930 3300035692 Bacteria 950
80 Ga0373925_0228960 3300037068 Bacteria 1486
81 Ga0373925_0950481 3300037068 Bacteria 708
82 Ga0395900_0151736 3300037418 Bacteria 2367
83 Ga0436364_1022085 3300037853 Bacteria 5895
84 Ga0395901_0432171 3300038443 Bacteria 1349
85 Ga0395901_1107335 3300038443 Bacteria 762
86 Ga0436365_1762335 3300039437 Bacteria 1432
87 Ga0436360_0619897 3300039438 Bacteria 1046
88 Ga0436363_1265699 3300039450 Bacteria 781
89 Ga0466972_0000200 3300044658 Bacteria 43953
90 Ga0466965_0189784 3300044683 Bacteria 1087
91 Ga0466966_0209826 3300044684 Bacteria 1177
92 Ga0466968_0180381 3300044735 Bacteria 982
93 Ga0466959_0552867 3300045049 Bacteria 776
94 Ga0495590_0103888 3300046457 Bacteria 1011
95 Ga0495638_0254799 3300046460 Bacteria 966
96 Ga0495584_0183242 3300046491 Bacteria 1064
97 Ga0495584_0253463 3300046491 Bacteria 895
98 Ga0495606_0231224 3300046507 Bacteria 1036
99 Ga0495610_0124124 3300046512 Bacteria 1128
100 Ga0495632_0115368 3300046519 Bacteria 1258
101 Ga0495586_0079234 3300046535 Bacteria 1803
102 Ga0495625_0302790 3300046660 Bacteria 1022
103 Ga0495625_0454481 3300046660 Bacteria 791
104 Ga0495625_0508602 3300046660 Bacteria 735
105 Ga0495669_0316960 3300046684 Bacteria 752
106 Ga0495613_0688144 3300046689 Bacteria 674
107 Ga0496100_0332934 3300048903 Bacteria 1143
108 Ga0496102_0041601 3300048905 Bacteria 4162
109 Ga0496102_0772141 3300048905 Bacteria 884
110 Ga0496114_0227624 3300048917 Bacteria 1638
111 Ga0496126_0034620 3300048929 Bacteria 4742
112 Ga0496126_0652015 3300048929 Bacteria 823
113 Ga0501047_0135983 3300049581 Bacteria 2338
114 Ga0501070_0107723 3300049586 Bacteria 2303
115 Ga0501081_0366772 3300049743 Bacteria 1063
116 Ga0501083_0254095 3300049744 Bacteria 1144
117 Ga0501035_0125294 3300049822 Bacteria 2243
118 Ga0501035_0336427 3300049822 Bacteria 1266
119 Ga0501044_0167936 3300049823 Bacteria 2167
120 nmdc:mga03683_68220_c1 3300050489 Bacteria 1515
121 nmdc:mga03n38_86759_c1 3300050490 Bacteria 1482
122 nmdc:mga0yw44_434113_c1 3300050492 Bacteria 890
123 nmdc:mga0yw44_528346_c1 3300050492 Bacteria 801
124 nmdc:mga0k408_361959_c1 3300050493 Bacteria 864
125 nmdc:mga06z11_267364_c1 3300050494 Bacteria 1010
126 nmdc:mga04h51_143285_c1 3300050495 Bacteria 908
127 nmdc:mga07m45_241548_c1 3300050496 Bacteria 1051
128 nmdc:mga05p37_269089_c2 3300050507 Bacteria 884
129 nmdc:mga06r32_199961_c2 3300050510 Bacteria 1188
130 nmdc:mga08y16_40487_c1 3300050511 Bacteria 4885
131 nmdc:mga0n895_1013234_c1 3300050512 Bacteria 811
132 nmdc:mga0n895_39599_c1 3300050512 Bacteria 4574
133 nmdc:mga0a205_172037_c1 3300050515 Bacteria 2062
134 Ga0495601_0578005 3300053077 Bacteria 722
135 Ga0500635_0158809 3300053080 Bacteria 866
136 Ga0500646_0272158 3300053090 Bacteria 601
137 Ga0500554_017503 3300053102 Bacteria 1916
138 Ga0500572_002778 3300053111 Bacteria 4131
139 Ga0500642_0244431 3300053130 Bacteria 826
140 Ga0500559_0002070 3300053136 Bacteria 10730
141 Ga0500577_0215439 3300053142 Bacteria 830
142 Ga0500603_000367 3300053150 Bacteria 11797
143 Ga0500638_205882 3300053162 Bacteria 828
144 Ga0500639_108395 3300053163 Bacteria 1355
145 Ga0500637_0000178 3300053178 Bacteria 23661
146 Ga0500637_0073319 3300053178 Bacteria 1971
147 Ga0500596_004368 3300053735 Bacteria 2595

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039437 Ga0436365_1762335 Ga0436365_1762335_743_1282 166
2 3300048917 Ga0496114_0227624 Ga0496114_0227624_161_907 168
3 3300049822 Ga0501035_0336427 Ga0501035_0336427_500_1027 172
4 iso_pu_bacteria 2513237104 2513719504 173
5 iso_pu_bacteria 2524023210 2524470306 173
6 iso_pu_bacteria 2721755755 2723849054 173
7 iso_pu_bacteria 2847939898 2847940283 173
8 iso_pu_bacteria 2874604998 2874607047 173
9 iso_pu_bacteria 2876808645 2876812289 173
10 iso_pu_bacteria 2879110137 2879117120 173
11 iso_pu_bacteria 2904699407 2904707950 173
12 iso_pu_bacteria 2935648319 2935653300 173
13 iso_pu_bacteria 2935656913 2935660229 173
14 iso_pu_bacteria 2936011229 2936016170 173
15 iso_pu_bacteria 2936019824 2936024803 173
16 iso_pu_bacteria 2936028420 2936032051 173
17 iso_pu_bacteria 2936046547 2936049912 173
18 iso_pu_bacteria 2936055302 2936060864 173
19 iso_pu_bacteria 8056673599 8056679814 173
20 iso_pu_bacteria 2802429603 2805919021 174
21 iso_pu_bacteria 2824696289 2824702570 174
22 3300005293 Ga0065715_10164891 Ga0065715_101648912 176
23 3300005544 Ga0070686_100191506 Ga0070686_1001915062 176
24 3300006847 Ga0075431_100401928 Ga0075431_1004019282 176
25 3300009094 Ga0111539_10131590 Ga0111539_101315902 176
26 3300025917 Ga0207660_11050034 Ga0207660_110500341 176
27 3300045049 Ga0466959_0552867 Ga0466959_0552867_217_750 176
28 3300046660 Ga0495625_0454481 Ga0495625_0454481_18_551 176
29 3300050510 nmdc:mga06r32_199961_c2 nmdc:mga06r32_199961_c2_237_767 176
30 2162886012 MBSR1b_contig_4859628 MBSR1b_0887.00005550 177
31 3300005293 Ga0065715_10350269 Ga0065715_103502691 177
32 3300005331 Ga0070670_100646197 Ga0070670_1006461972 177
33 3300005335 Ga0070666_10680424 Ga0070666_106804241 177
34 3300005347 Ga0070668_100327861 Ga0070668_1003278612 177
35 3300005347 Ga0070668_100369919 Ga0070668_1003699191 177
36 3300005356 Ga0070674_100498674 Ga0070674_1004986741 177
37 3300005365 Ga0070688_100458970 Ga0070688_1004589701 177
38 3300005367 Ga0070667_100225161 Ga0070667_1002251611 177
39 3300005367 Ga0070667_100695286 Ga0070667_1006952862 177
40 3300005544 Ga0070686_100565091 Ga0070686_1005650911 177
41 3300005564 Ga0070664_101224786 Ga0070664_1012247861 177
42 3300005617 Ga0068859_101117917 Ga0068859_1011179171 177
43 3300005842 Ga0068858_100179677 Ga0068858_1001796772 177
44 3300005843 Ga0068860_100461037 Ga0068860_1004610371 177
45 3300005844 Ga0068862_100135923 Ga0068862_1001359232 177
46 3300005983 Ga0081540_1151328 Ga0081540_11513281 177
47 3300005985 Ga0081539_10019880 Ga0081539_100198803 177
48 3300006028 Ga0070717_10901379 Ga0070717_109013791 177
49 3300006038 Ga0075365_10286895 Ga0075365_102868952 177
50 3300006038 Ga0075365_10431560 Ga0075365_104315601 177
51 3300006038 Ga0075365_10645046 Ga0075365_106450461 177
52 3300006048 Ga0075363_100092881 Ga0075363_1000928812 177
53 3300006048 Ga0075363_100290204 Ga0075363_1002902042 177
54 3300006178 Ga0075367_10182276 Ga0075367_101822762 177
55 3300006844 Ga0075428_100237303 Ga0075428_1002373032 177
56 3300006852 Ga0075433_10099515 Ga0075433_100995153 177
57 3300006871 Ga0075434_101669093 Ga0075434_1016690931 177
58 3300006914 Ga0075436_100163338 Ga0075436_1001633382 177
59 3300006931 Ga0097620_101117963 Ga0097620_1011179631 177
60 3300007265 Ga0099794_10120288 Ga0099794_101202882 177
61 3300007788 Ga0099795_10033238 Ga0099795_100332381 177
62 3300007788 Ga0099795_10038444 Ga0099795_100384443 177
63 3300009094 Ga0111539_10160821 Ga0111539_101608212 177
64 3300009101 Ga0105247_10197616 Ga0105247_101976162 177
65 3300009148 Ga0105243_10342237 Ga0105243_103422371 177
66 3300009545 Ga0105237_10217289 Ga0105237_102172893 177
67 3300009553 Ga0105249_11373440 Ga0105249_113734401 177
68 3300010159 Ga0099796_10007915 Ga0099796_100079153 177
69 3300010159 Ga0099796_10147748 Ga0099796_101477482 177
70 3300011119 Ga0105246_10800605 Ga0105246_108006051 177
71 3300011119 Ga0105246_11334232 Ga0105246_113342321 177
72 3300013306 Ga0163162_11335730 Ga0163162_113357301 177
73 3300014325 Ga0163163_10954962 Ga0163163_109549621 177
74 3300014326 Ga0157380_11000262 Ga0157380_110002622 177
75 3300014968 Ga0157379_10399251 Ga0157379_103992512 177
76 3300025297 Ga0209758_1018411 Ga0209758_10184113 177
77 3300025900 Ga0207710_10123658 Ga0207710_101236582 177
78 3300025901 Ga0207688_10337843 Ga0207688_103378432 177
79 3300025903 Ga0207680_10695716 Ga0207680_106957161 177
80 3300025915 Ga0207693_10776743 Ga0207693_107767431 177
81 3300025925 Ga0207650_10968584 Ga0207650_109685841 177
82 3300025928 Ga0207700_11052953 Ga0207700_110529531 177
83 3300025935 Ga0207709_10740616 Ga0207709_107406161 177
84 3300025937 Ga0207669_10616798 Ga0207669_106167982 177
85 3300025941 Ga0207711_10457878 Ga0207711_104578782 177
86 3300025942 Ga0207689_10354531 Ga0207689_103545312 177
87 3300025961 Ga0207712_10533658 Ga0207712_105336581 177
88 3300025972 Ga0207668_10052248 Ga0207668_100522482 177
89 3300025986 Ga0207658_10245724 Ga0207658_102457241 177
90 3300026121 Ga0207683_10920772 Ga0207683_109207722 177
91 3300027512 Ga0209179_1000866 Ga0209179_10008663 177
92 3300027671 Ga0209588_1031067 Ga0209588_10310672 177
93 3300027907 Ga0207428_10230969 Ga0207428_102309692 177
94 3300028379 Ga0268266_10012197 Ga0268266_100121972 177
95 3300028380 Ga0268265_10082570 Ga0268265_100825703 177
96 3300028381 Ga0268264_10283897 Ga0268264_102838972 177
97 3300031247 Ga0265340_10145582 Ga0265340_101455822 177
98 3300031730 Ga0307516_10313678 Ga0307516_103136782 177
99 3300033180 Ga0307510_10080319 Ga0307510_100803192 177
100 3300035121 Ga0373960_0220977 Ga0373960_0220977_78_611 177
101 3300035172 Ga0373955_0434954 Ga0373955_0434954_65_601 177
102 3300035691 Ga0373931_0141609 Ga0373931_0141609_777_1310 177
103 3300035692 Ga0373935_0430930 Ga0373935_0430930_289_825 177
104 3300037068 Ga0373925_0228960 Ga0373925_0228960_505_1041 177
105 3300037068 Ga0373925_0950481 Ga0373925_0950481_37_570 177
106 3300037418 Ga0395900_0151736 Ga0395900_0151736_1099_1680 177
107 3300037853 Ga0436364_1022085 Ga0436364_1022085_2731_3264 177
108 3300038443 Ga0395901_0432171 Ga0395901_0432171_609_1175 177
109 3300038443 Ga0395901_1107335 Ga0395901_1107335_34_570 177
110 3300039438 Ga0436360_0619897 Ga0436360_0619897_183_725 177
111 3300039450 Ga0436363_1265699 Ga0436363_1265699_71_607 177
112 3300044658 Ga0466972_0000200 Ga0466972_0000200_39791_40348 177
113 3300044683 Ga0466965_0189784 Ga0466965_0189784_416_973 177
114 3300044684 Ga0466966_0209826 Ga0466966_0209826_180_716 177
115 3300044735 Ga0466968_0180381 Ga0466968_0180381_333_890 177
116 3300046457 Ga0495590_0103888 Ga0495590_0103888_376_912 177
117 3300046460 Ga0495638_0254799 Ga0495638_0254799_55_639 177
118 3300046491 Ga0495584_0183242 Ga0495584_0183242_306_842 177
119 3300046491 Ga0495584_0253463 Ga0495584_0253463_87_623 177
120 3300046507 Ga0495606_0231224 Ga0495606_0231224_310_846 177
121 3300046512 Ga0495610_0124124 Ga0495610_0124124_525_1061 177
122 3300046519 Ga0495632_0115368 Ga0495632_0115368_279_815 177
123 3300046535 Ga0495586_0079234 Ga0495586_0079234_578_1111 177
124 3300046660 Ga0495625_0302790 Ga0495625_0302790_296_832 177
125 3300046660 Ga0495625_0508602 Ga0495625_0508602_42_578 177
126 3300046684 Ga0495669_0316960 Ga0495669_0316960_63_599 177
127 3300046689 Ga0495613_0688144 Ga0495613_0688144_87_623 177
128 3300048903 Ga0496100_0332934 Ga0496100_0332934_389_925 177
129 3300048905 Ga0496102_0041601 Ga0496102_0041601_3313_3849 177
130 3300048905 Ga0496102_0772141 Ga0496102_0772141_175_711 177
131 3300048929 Ga0496126_0034620 Ga0496126_0034620_1073_1609 177
132 3300048929 Ga0496126_0652015 Ga0496126_0652015_189_725 177
133 3300049581 Ga0501047_0135983 Ga0501047_0135983_1600_2133 177
134 3300049586 Ga0501070_0107723 Ga0501070_0107723_1290_1823 177
135 3300049743 Ga0501081_0366772 Ga0501081_0366772_424_957 177
136 3300049744 Ga0501083_0254095 Ga0501083_0254095_238_771 177
137 3300049822 Ga0501035_0125294 Ga0501035_0125294_312_845 177
138 3300049823 Ga0501044_0167936 Ga0501044_0167936_196_729 177
139 3300050489 nmdc:mga03683_68220_c1 nmdc:mga03683_68220_c1_347_883 177
140 3300050490 nmdc:mga03n38_86759_c1 nmdc:mga03n38_86759_c1_355_888 177
141 3300050492 nmdc:mga0yw44_434113_c1 nmdc:mga0yw44_434113_c1_214_750 177
142 3300050492 nmdc:mga0yw44_528346_c1 nmdc:mga0yw44_528346_c1_184_720 177
143 3300050493 nmdc:mga0k408_361959_c1 nmdc:mga0k408_361959_c1_225_764 177
144 3300050494 nmdc:mga06z11_267364_c1 nmdc:mga06z11_267364_c1_352_891 177
145 3300050495 nmdc:mga04h51_143285_c1 nmdc:mga04h51_143285_c1_50_583 177
146 3300050496 nmdc:mga07m45_241548_c1 nmdc:mga07m45_241548_c1_440_973 177
147 3300050507 nmdc:mga05p37_269089_c2 nmdc:mga05p37_269089_c2_37_570 177
148 3300050511 nmdc:mga08y16_40487_c1 nmdc:mga08y16_40487_c1_2566_3105 177
149 3300050512 nmdc:mga0n895_1013234_c1 nmdc:mga0n895_1013234_c1_129_671 177
150 3300050512 nmdc:mga0n895_39599_c1 nmdc:mga0n895_39599_c1_2578_3117 177
151 3300050515 nmdc:mga0a205_172037_c1 nmdc:mga0a205_172037_c1_392_931 177
152 3300053077 Ga0495601_0578005 Ga0495601_0578005_120_656 177
153 3300053080 Ga0500635_0158809 Ga0500635_0158809_75_617 177
154 3300053090 Ga0500646_0272158 Ga0500646_0272158_34_576 177
155 3300053102 Ga0500554_017503 Ga0500554_017503_121_663 177
156 3300053111 Ga0500572_002778 Ga0500572_002778_2170_2706 177
157 3300053130 Ga0500642_0244431 Ga0500642_0244431_245_781 177
158 3300053136 Ga0500559_0002070 Ga0500559_0002070_581_1117 177
159 3300053142 Ga0500577_0215439 Ga0500577_0215439_232_768 177
160 3300053150 Ga0500603_000367 Ga0500603_000367_10692_11234 177
161 3300053162 Ga0500638_205882 Ga0500638_205882_240_776 177
162 3300053163 Ga0500639_108395 Ga0500639_108395_219_770 177
163 3300053178 Ga0500637_0000178 Ga0500637_0000178_11823_12365 177
164 3300053178 Ga0500637_0073319 Ga0500637_0073319_473_1024 177
165 3300053735 Ga0500596_004368 Ga0500596_004368_205_741 177

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01797

Y1_Tnp

Transposase IS200 like

15

132

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4er8-assembly1.cif.gz_A structure of the rep associates tyrosine transposase bound to a rep hairpin 0.8599 1 177
4er8-assembly1.cif.gz_A structure of the rep associates tyrosine transposase bound to a rep hairpin 0.8396 1 177
6pns-assembly1.cif.gz_A in situ structure of btv rna-dependent rna polymerase in btv virion 0.7188 32 86
2xo6-assembly1.cif.gz_D deinococcus radiodurans isdra2 transposase y132f mutant complexed with left end recognition and cleavage site 0.6974 5 119
6oj6-assembly1.cif.gz_P in situ structure of rotavirus vp1 rna-dependent rna polymerase (dlp_rna) 0.6933 32 86
ID Description Score Start End Superfamily
4er8A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Transposase IS200-like 0.8599 1 177 3.30.70.1290
4er8A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Transposase IS200-like 0.8396 1 177 3.30.70.1290
2vihA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Transposase IS200-like 0.7188 3 119 3.30.70.1290
2vjvB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Transposase IS200-like 0.6915 5 119 3.30.70.1290
2xm3E00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Transposase IS200-like 0.6874 5 119 3.30.70.1290
ID Description Score Start End GO Terms
AF-A0A7W9Z850-F1-model_v4 REP element-mobilizing transposase RayT 0.9448 2 89 GO:0004803
GO:0006313
GO:0043565
AF-A0A497Z8V2-F1-model_v4 Transposase IS200 family protein 0.937 1 87 GO:0003677
GO:0004803
GO:0006313
AF-A0A357MJG7-F1-model_v4 Transposase 0.9341 1 88 GO:0004803
GO:0006313
GO:0043565
AF-A0A4C9EU92-F1-model_v4 Transposase 0.9306 1 83 GO:0004803
GO:0006313
GO:0043565
AF-A0A5C7XP11-F1-model_v4 Transposase 0.9271 1 163 GO:0004803
GO:0006313
GO:0043565

Feature Viewer

pLDDT pTM Quality
84.38 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map